DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and khdrbs1b

DIOPT Version :8

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_998400.1 Gene:khdrbs1b / 406516 ZFINID:ZDB-GENE-040426-2344 Length:352 Species:Danio rerio

Alignment Length:302 Identity:99/303 (33%)
Similarity:157/303 (52%) Gaps:58/303 (19%)


  Fly    75 KYMQELMTERSRMENHFPLAVKLIDEALERVQLNGRIPTRDQYADVYQQRTIKLSQKVHVPIKD- 138
            ||:.:|:.||..::..|..|:|||...:|:::........:.|.|::..:.|||.:::.:|:|. 
Zfish     6 KYLPQLLAERDSLDPSFTHAMKLISAEIEKIEKGDTEKDTESYLDLFTMKNIKLKERILIPVKQY 70

  Fly   139 KKFNYVGKLLGPKGNSLRRLQEETQCKIVILGRFSMKDRAREEELRNSADAKYAHLNLPLHVEVS 203
            .|||:|||:|||:||:::||||||..||.:||:.||:|:.:|||||.:.:.|||||::.|||.:.
Zfish    71 PKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKNKEEELRKNGEPKYAHLSMELHVFIE 135

  Fly   204 TIAPPAEAYARVAYALAEIRRYLTPDKHDDIRQEQYRELMEDPEAAKKLTLRQLQQQSNAAASGA 268
            ..||..:||.|:|:|:.||:::|.||..|||.|||:.|            ::.|.........|.
Zfish   136 VFAPVPDAYMRMAHAMEEIKKFLFPDMMDDICQEQFME------------MKFLNGGQEHGGRGR 188

  Fly   269 GG----------------------GGGGGGGNGNGGAAGSGSNNGNGN-----QRSGGNYRQK-- 304
            ||                      .|||.||...|||| .|:..|.|.     .|...:.|.:  
Zfish   189 GGPPIRGRGGLPPPGAPRGRGMPPRGGGRGGPPRGGAA-RGAPAGRGGPSAQLPRGAASNRARPP 252

  Fly   305 -----------FQQQSHYRHNEETVY----FRSHNNAYHQPK 331
                       ..|:|:..::.:..|    :.|:::.|.||:
Zfish   253 APGAPRMPPPPQTQESYDEYSYDESYADTGYESYDSYYSQPQ 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 58/116 (50%)
khdrbs1bNP_998400.1 Qua1 7..56 CDD:292891 12/49 (24%)
SF1_like-KH 60..178 CDD:239088 59/130 (45%)
Sam68-YY 269..319 CDD:293176 5/27 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C102810912
eggNOG 1 0.900 E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 204 1.000 Inparanoid score I3641
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128560
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11208
Phylome 1 0.910 0.944 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.