DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and nsr

DIOPT Version :8

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001286736.1 Gene:nsr / 37577 FlyBaseID:FBgn0034740 Length:340 Species:Drosophila melanogaster

Alignment Length:298 Identity:129/299 (43%)
Similarity:169/299 (57%) Gaps:33/299 (11%)


  Fly    53 EHENEHNANADGEKAQPA--PAVQKYMQELMTERSRMENHFPLAVKLIDEALERVQLNGRIPTRD 115
            |.:|:.....|....||.  ...||::.:|..||.|:...|||...||||:::||...||||.::
  Fly     9 EEQNQDQPTQDQPTYQPRLNEVAQKFLADLDEERKRLSAEFPLCALLIDESVDRVFSTGRIPGKE 73

  Fly   116 QYADVYQQRTIKLSQKVHVPI-KDKKFNYVGKLLGPKGNSLRRLQEETQCKIVILGRFSMKDRAR 179
            .|||||.||.:|::|||.||: |..|||:..|:|||||||:|||:|||.|||||.||.||:||.:
  Fly    74 FYADVYHQRPMKITQKVFVPVNKFPKFNFARKILGPKGNSVRRLKEETNCKIVIKGRSSMRDRNK 138

  Fly   180 EEELRNSADAKYAHLNLPLHVEVSTIAPPAEAYARVAYALAEIRRYLTPDKHDDIRQEQYRELME 244
            |||||:|.|.:||||:..|.:|||.:|||||.|||:||||||||:||.||.:||:..||.|||||
  Fly   139 EEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEIRKYLIPDDNDDVWHEQQRELME 203

  Fly   245 -DPEAAKKLTLRQLQQQSNAAASGAGGGGGGGGGNGNGGAAGSGSNNGNGNQRSGGNYRQKFQQQ 308
             :||:|||.....:....:......||                   |.||..:.....|:..:..
  Fly   204 MNPESAKKSNGLNMAPYRSIFDKTIGG-------------------NRNGAPKYNNQIRRVTENP 249

  Fly   309 SHYRHNEETVY-FRSHNN---------AYHQPKPYVPA 336
            ......||..| :..|..         .|.:|.|.:.|
  Fly   250 REVADMEEVEYDYDEHRMPPSRPSLGFEYSKPPPSMTA 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 77/116 (66%)
nsrNP_001286736.1 SF1_like-KH 87..206 CDD:239088 78/119 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130763457
eggNOG 1 0.900 E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11208
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.