DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and qkr58E-1

DIOPT Version :8

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster

Alignment Length:415 Identity:132/416 (32%)
Similarity:204/416 (49%) Gaps:79/416 (19%)


  Fly    36 AGTGVVPTGVSGGTSNGEHENEHNANAD----GEKAQPAPAVQKYMQELMTERSRMENHFPLAVK 96
            |.||...|..:.|   |.|...|.|..|    .||      ...|:||.:.|:..:|....:..:
  Fly    26 AATGAPETPEADG---GGHTTSHAALRDTPQLNEK------TNAYLQECLLEKKTLEKKHIITKR 81

  Fly    97 LIDEALERVQLNGRIPTRDQYADVYQQRTIKLSQKVHVPIKD-KKFNYVGKLLGPKGNSLRRLQE 160
            |:|:.:|::.::||||..:.||:||.::.|:::|||..|||: .|||:|||:||||||:||:|||
  Fly    82 LLDDEVEKILVSGRIPKPEIYANVYSEKPIRVAQKVLFPIKEYPKFNFVGKILGPKGNTLRQLQE 146

  Fly   161 ETQCKIVILGRFSMKDRAREEELRNSADAKYAHLNLPLHVEVSTIAPPAEAYARVAYALAEIRRY 225
            ||.||:|::||.||:|..:|||||:|.:.|||||:..||||:||:|||||||.|::|||.|||::
  Fly   147 ETMCKMVVMGRNSMRDHGKEEELRSSGNPKYAHLSRDLHVEISTVAPPAEAYHRISYALGEIRKF 211

  Fly   226 LTPDKHDDIRQEQYRELMEDPEAAKKLTLRQLQQQSNAAASGAGGGGGGGG-------------- 276
            :.||.:||||.||.|| |:..|        ::.::|:..:...|..|....              
  Fly   212 MIPDANDDIRLEQLRE-MDGKE--------RMYKKSHHYSKSYGDHGAYSSRTPPPASSKPKVYS 267

  Fly   277 ---------GNGNGGAAGSGSNNGNGNQRSGGNY-------RQKFQQQSHYRHNEETVYFRSHNN 325
                     .:.|.|...:..:..:......|.|       .|..:..:|:...:.:.|.|.:..
  Fly   268 ILEKARYVMDDPNYGIVKTHRSRDHELYDHHGEYDRYATPPPQTSKHSTHHAQYDSSSYERDYRR 332

  Fly   326 AYHQPKPYVPAAQRGNAMHTTLPPQAIVRASPPGMVVSAASFNGRNAGLGNAGGGGIMANSIVAT 390
            .||.              |::....|....:.|....|::|:....:|.|:........      
  Fly   333 EYHP--------------HSSSSSYAAAYPAKPSNGRSSSSYRPTTSGSGSHSSAHYET------ 377

  Fly   391 TGGGIGGAVPPNMRYRPAAPYQFVK 415
                 |.....::||| :|||..::
  Fly   378 -----GSRSRESVRYR-SAPYPKIR 396

Known Domains:


GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 75/116 (65%)
qkr58E-1NP_523809.2 SF1_like-KH 115..236 CDD:239088 76/130 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130763673
eggNOG 1 0.900 E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 204 1.000 Inparanoid score I3641
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11208
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.