DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and vamp-7

DIOPT Version :8

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_500232.3 Gene:vamp-7 / 177041 WormBaseID:WBGene00022077 Length:261 Species:Caenorhabditis elegans

Alignment Length:176 Identity:40/177 (23%)
Similarity:65/177 (37%) Gaps:63/177 (36%)


  Fly    98 IDEALERVQLNGRIPTRDQYADVYQQRTIKLSQKVHVPIKDKKFNYVGKLLGPKGNSLRRLQEET 162
            |:||||  .||.:|.:...|:::  |..|..|...             .|||       .||.:.
 Worm    97 IEEALE--FLNSKIRSIMDYSNI--QMVIAQSNAY-------------DLLG-------HLQPDI 137

  Fly   163 QCKIVILGRFSMKDRAREEELRNSADAKYAHLNLP--LHVEVSTIAPPAEAYARVAYALAEIRRY 225
             .|.::  .||:                :.||||.  |..:.:...|.|:....:     :|||.
 Worm   138 -LKFIV--SFSV----------------FFHLNLDFFLQKQHNETFPTAQQQRMI-----DIRRQ 178

  Fly   226 LTPDKHDDIRQ---EQYRELMEDPEAAKKLTLRQLQQQSNAAASGA 268
            :     ||:||   :....:||..|     .|..::.::.|..:.|
 Worm   179 V-----DDVRQVMADNVERIMERGE-----RLENMENRTEALRTSA 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 24/120 (20%)
vamp-7NP_500232.3 Synaptobrevin 168..256 CDD:279324 13/63 (21%)
R-SNARE 175..229 CDD:277196 13/51 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.