DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and E02D9.1

DIOPT Version :8

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_740881.1 Gene:E02D9.1 / 172405 WormBaseID:WBGene00017098 Length:427 Species:Caenorhabditis elegans

Alignment Length:266 Identity:53/267 (20%)
Similarity:95/267 (36%) Gaps:70/267 (26%)


  Fly    64 GEKAQPAPAVQKYMQ--------------ELMTERSRMENHFPLAVKLIDEALERV-------QL 107
            ||.|:|     :.:|              ||.:|...:.|:|.|....:|.|:.:|       :.
 Worm    62 GELAEP-----RCLQLPEHLWRFWDILIAELKSEIPEIRNNFKLKYNDVDGAILKVRGADDFEKF 121

  Fly   108 NGRIPTRDQYADVY---------QQRTIKLSQKVHV-PIKDKKFNYVGKLLGPKGNSLRRLQEET 162
            :.|:...|:..::.         ...:...||.|.: |.:.::..|||.  |........|.|:|
 Worm   122 SERLENTDENEEIVLILENISSKNDESSGNSQNVRIFPSELQRGKYVGN--GMHATVRMALHEKT 184

  Fly   163 QCKIVILGRFSMK-DRAR-EEELRNSADAKYAHLNLPLH-VEVSTIAP----------------- 207
            |...||....|.. |:.. |:|:....:...:...:..| .|||:|..                 
 Worm   185 QKWYVIKTILSQNTDKTEYEKEILAYEECSQSDYVVGYHGCEVSSIKKELVLEYMDKGDFRPFGI 249

  Fly   208 -PAEAYARVAYALAEIRRYLTPDK----HDDIRQEQYRELMEDPEAAKKL----TLRQLQQQSNA 263
             |...:..||.:|....|::....    |.||:.|   .::.:.:...|:    ..:::......
 Worm   250 LPFSVHQSVALSLIRAIRHVWNSGPGYIHRDIKPE---NILVNSQGYVKICDFGAAKRIDNTYRI 311

  Fly   264 AASGAG 269
            |:|.||
 Worm   312 ASSAAG 317

Known Domains:


GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 32/141 (23%)
E02D9.1NP_740881.1 S_TKc 163..406 CDD:214567 33/161 (20%)
PKc 169..403 CDD:270622 31/155 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C102862075
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11208
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.