DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and Khdrbs2

DIOPT Version :8

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_579852.1 Gene:Khdrbs2 / 170843 RGDID:621738 Length:349 Species:Rattus norvegicus

Alignment Length:312 Identity:112/313 (36%)
Similarity:162/313 (52%) Gaps:65/313 (21%)


  Fly    74 QKYMQELMTERSRMENHFPLAVKLIDEALERVQ-LNGRIPTRD-QYADVYQQRTIKLSQKVHVPI 136
            :||:.|||.|:..::..|..|.:|:.|.:|:.| .:||....: :|.||...:.||||::|.:|:
  Rat     4 EKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGRKEDEEKKYLDVISNKNIKLSERVLIPV 68

  Fly   137 KD-KKFNYVGKLLGPKGNSLRRLQEETQCKIVILGRFSMKDRAREEELRNSADAKYAHLNLPLHV 200
            |. .|||:|||||||:||||:||||||..|:.|||:.||:|:|:|||||.|.:||||||:..|||
  Rat    69 KQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHV 133

  Fly   201 EVSTIAPPAEAYARVAYALAEIRRYLTPDKHDDIRQEQYRELMEDPEAAKKLTLRQLQQQSNAAA 265
            .:...|||.|||:|:::||.||:::|.||.:|:|||||               ||:|...:.:..
  Rat   134 LIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQ---------------LRELSYLNGSEE 183

  Fly   266 SGAGGGGGGGG--------GNGNGGAAGSGSNNGNG------------------------NQRSG 298
            ||.|.|..|.|        ..|.|||.......|.|                        ..|:.
  Rat   184 SGRGRGIRGRGIRITPTAPSRGRGGAVPPPPPPGRGVLTPRGTTVTRGALPVPPVARGVPTPRAR 248

  Fly   299 G-----NYR----------QKFQQQSHYRHNEETVYFRSHNNAYHQPKPYVP 335
            |     .||          :::.....|....:...:.:::|:|..|...||
  Rat   249 GTAAVPGYRAPPPPAPEAYEEYGYDDGYGGEYDDQTYEAYDNSYVTPTQSVP 300

Known Domains:


GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 67/116 (58%)
Khdrbs2NP_579852.1 Qua1 6..57 CDD:292891 16/51 (31%)
SF1_like-KH 61..180 CDD:239088 70/134 (52%)
Sam68-YY 271..321 CDD:293176 6/31 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C102839943
eggNOG 1 0.900 E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 204 1.000 Inparanoid score I3612
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T131067
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11208
Phylome 1 0.910 0.944 Consistency score
TreeFam 1 0.960
87.860

Return to query results.
Submit another query.