DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and Khdrbs2

DIOPT Version :8

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_573498.1 Gene:Khdrbs2 / 170771 MGIID:2159649 Length:349 Species:Mus musculus

Alignment Length:312 Identity:110/313 (35%)
Similarity:161/313 (51%) Gaps:65/313 (21%)


  Fly    74 QKYMQELMTERSRMENHFPLAVKLIDEALERVQ-LNGRIPTRD-QYADVYQQRTIKLSQKVHVPI 136
            :||:.|||.|:..::..|..|.:|:.|.:|:.| .:|:....: :|.||...:.||||::|.:|:
Mouse     4 EKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPV 68

  Fly   137 KD-KKFNYVGKLLGPKGNSLRRLQEETQCKIVILGRFSMKDRAREEELRNSADAKYAHLNLPLHV 200
            |. .|||:|||||||:||||:||||||..|:.|||:.||:|:.:|||||.|.:||||||:..|||
Mouse    69 KQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKTKEEELRKSGEAKYAHLSDELHV 133

  Fly   201 EVSTIAPPAEAYARVAYALAEIRRYLTPDKHDDIRQEQYRELMEDPEAAKKLTLRQLQQQSNAAA 265
            .:...|||.|||:|:::||.||:::|.||.:|:|||||               ||:|...:.:..
Mouse   134 LIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQ---------------LRELSYLNGSEE 183

  Fly   266 SGAGGGGGGGG--------GNGNGGAAGSGSNNGNG------------------------NQRSG 298
            ||.|.|..|.|        ..|.|||.......|.|                        ..|:.
Mouse   184 SGRGRGIRGRGIRITPTAPSRGRGGAVPPPPPPGRGVLTPRGTTVTRGALPVPPIARGVPTPRAR 248

  Fly   299 G-----NYR----------QKFQQQSHYRHNEETVYFRSHNNAYHQPKPYVP 335
            |     .||          :::.....|....:...:.:::|:|..|...||
Mouse   249 GTAAVPGYRAPPPPAHDAYEEYGYDDGYGGEYDDQTYEAYDNSYVTPTQSVP 300

Known Domains:


GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 66/116 (57%)
Khdrbs2NP_573498.1 Qua1 6..57 CDD:292891 15/51 (29%)
SF1_like-KH 61..180 CDD:239088 69/134 (51%)
Sam68-YY 267..321 CDD:293176 6/35 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C102839122
eggNOG 1 0.900 E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 208 1.000 Inparanoid score I3657
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130827
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11208
Phylome 1 0.910 0.944 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.850

Return to query results.
Submit another query.