DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and khdrbs3

DIOPT Version :8

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_002932263.1 Gene:khdrbs3 / 100379996 XenbaseID:XB-GENE-941483 Length:342 Species:Xenopus tropicalis

Alignment Length:347 Identity:121/348 (35%)
Similarity:169/348 (49%) Gaps:95/348 (27%)


  Fly    73 VQKYMQELMTERSRMENHFPLAVKLIDEALERVQLNGRIPTRDQYADVYQQRTIKLSQKVHVPIK 137
            ::||:.:|:.|:..::..|..|::::.|.:|::| .|...|.|||.||...:.:||:|||.:|||
 Frog     1 MEKYLPQLLAEKDALDPSFTHALRMVKEEIEKLQ-KGEDNTEDQYIDVVINKNMKLAQKVLIPIK 64

  Fly   138 D-KKFNYVGKLLGPKGNSLRRLQEETQCKIVILGRFSMKDRAREEELRNSADAKYAHLNLPLHVE 201
            . .|||:|||||||:||||:||||:|..|:.|||:.||:|:|:|||||.|.:|||.|||..|||.
 Frog    65 QFPKFNFVGKLLGPRGNSLKRLQEDTLTKMSILGKGSMRDKAKEEELRKSGEAKYYHLNDDLHVL 129

  Fly   202 VSTIAPPAEAYARVAYALAEIRRYLTPDKHDDIRQEQYRELM---EDPEAAKKLTLRQLQQQSNA 263
            :...|||||||||:.:||.||:::|.||.:|:|||.|.:||.   ..||..:...:|        
 Frog   130 IEVFAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGPETTEAPVVR-------- 186

  Fly   264 AASGAGGGGGGGGGNGNGGAAGSGSNNGNGNQRSGGNYRQKFQQQSHYRHNEETVYFRSHNNAYH 328
                                       |..:.|:.|                             
 Frog   187 ---------------------------GKPSIRARG----------------------------- 195

  Fly   329 QPKPYVPAAQRGNAMHTTLP--PQAIVRASP-PGMVVSAASFNGRNAGLGNAGGGGIMANSIVAT 390
            .|.|.:|..:.|      :|  |..:.|.:| |..|..|...:.|..||             |||
 Frog   196 VPVPALPRGRGG------VPPAPTGVPRGAPAPRGVTPARVSSARARGL-------------VAT 241

  Fly   391 TGGGIGGAVPPNMRYRPAAPYQ 412
            ...||    ||...|||..|.|
 Frog   242 RARGI----PPPAGYRPPPPVQ 259

Known Domains:


GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 71/119 (60%)
khdrbs3XP_002932263.1 Qua1 4..52 CDD:292891 15/49 (31%)
SF1_like-KH 57..176 CDD:239088 71/119 (60%)
Sam68-YY 262..316 CDD:293176
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C102773444
eggNOG 1 0.900 E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.710

Return to query results.
Submit another query.