DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and iglon5

DIOPT Version :10

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:356 Identity:81/356 - (22%)
Similarity:142/356 - (39%) Gaps:80/356 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CSVVR----CLLAALILGQVQAELDFNNDLENSQKFKSIPTTVKTYENDTVQLPCTLNTPFRYVR 66
            |:::|    .|||.|..|...|:         :.:|..:|..:...|.::|.|.|.::....:..
Zfish     3 CAMLRHALALLLALLWKGPSGAQ---------AAEFGHLPDNITVLEGESVVLRCKIDEEVTHKA 58

  Fly    67 W-HRDDVALVDSRHPELPPPDRIMLWPNG----SLQVANVQSSDTGDYYCEMNSDSGHVVQQHAI 126
            | :|.::....:....|  ..|:.|..|.    |:::..|..:|.|.|.|...:.:    :....
Zfish    59 WLNRSNILFTGTDKWSL--DSRVSLENNNNSDFSIRIERVMVADEGPYTCSFQARN----KPRTA 117

  Fly   127 EVQLAPQVLIEPSDLTEQRI---GAIFEVVCEAQGVPQPVITWR------LN-GNVIQPQSNTGN 181
            .|.|..||.....::::.:.   |....:.|.|.|.|:|.|||:      || |..::       
Zfish   118 HVYLIVQVPARIVNISQDKSVNEGEDVNLFCLAVGRPEPTITWKDFKYGLLNEGEFLE------- 175

  Fly   182 RQSLILEIKSRNQAGLIECVASNGVGEPAVANVYLHVLFSPEV----SIPQPVVYTKLGSRAHLE 242
                |.||| |:||...||:.:|||..|....|.:.|.:.|.:    ::|     .::|..|.|.
Zfish   176 ----ITEIK-RHQAEDFECITNNGVAPPDTRKVKVTVNYPPIITDVKNMP-----AQVGKTAILR 230

  Fly   243 CIVEAAPAATVKWFHHGLPVALGAHSTTHESELQTNRSVDHYVNAVRHMLVVKSVRNADMGQYEC 307
            |...|.|.|:.:|:.            .....::::.::.......|.:|:..:|.....|.|.|
Zfish   231 CEAMAVPTASFEWYR------------DDRRPVESDNTLKIKNEKTRSLLLFTNVTEKHFGNYTC 283

  Fly   308 RASNQI-------------SVKSGSVELTGR 325
            .|||::             :|..|:..|.||
Zfish   284 FASNRLGASNASMLLFRPGAVYGGAASLNGR 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 IG_like 41..118 CDD:214653 17/81 (21%)
Ig strand B 52..56 CDD:409353 2/3 (67%)
Ig strand C 64..68 CDD:409353 1/4 (25%)
Ig strand E 94..98 CDD:409353 1/7 (14%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
Ig strand G 122..125 CDD:409353 0/2 (0%)
Ig 133..219 CDD:472250 28/95 (29%)
Ig strand B 150..154 CDD:409353 0/3 (0%)
Ig strand C 163..167 CDD:409353 2/3 (67%)
Ig strand E 183..187 CDD:409353 0/3 (0%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
Ig strand G 211..214 CDD:409353 0/2 (0%)
Ig_3 222..311 CDD:464046 17/92 (18%)
FN3 339..431 CDD:238020
iglon5NP_001017775.2 Ig 35..123 CDD:472250 18/93 (19%)
Ig strand B 44..48 CDD:409353 2/3 (67%)
Ig strand C 56..60 CDD:409353 0/3 (0%)
Ig strand E 89..93 CDD:409353 1/3 (33%)
Ig strand F 103..108 CDD:409353 2/4 (50%)
Ig strand G 116..119 CDD:409353 0/2 (0%)
Ig 122..207 CDD:472250 28/96 (29%)
Ig strand B 144..148 CDD:409353 0/3 (0%)
Ig strand C 157..161 CDD:409353 2/3 (67%)
Ig strand E 172..176 CDD:409353 0/14 (0%)
Ig strand F 186..191 CDD:409353 2/4 (50%)
Ig strand G 200..203 CDD:409353 0/2 (0%)
Ig_3 210..287 CDD:464046 17/93 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.