DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and dpr12

DIOPT Version :10

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:268 Identity:56/268 - (20%)
Similarity:96/268 - (35%) Gaps:95/268 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LWPNGSLQVANVQSSDTGDYYCEMNSDSGHVVQQHAIEVQLAPQVLIEPSDL----TEQRIGAIF 150
            ||..|.:         .||...:.|.||             :...:.|.|:|    |..::|...
  Fly    53 LWMRGGI---------NGDSKLDNNLDS-------------SDSPMFEDSELMAHNTTVQLGGTA 95

  Fly   151 EVVCEAQGVPQPVITW-------RLNGNVIQ--PQSNTGNRQSLI----------LEIK--SRNQ 194
            .:||:..||.:..:.|       |.:.:::.  .|..|.:.:..|          |:||  .|..
  Fly    96 FLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRD 160

  Fly   195 AGLIECVASNGVGEPAVANVYLHVLFSPEVSIPQPVV------YTKLGSRAHLECIVEAAPAAT- 252
            .|:.||..|...|      :..|.: :.:|.:|:..:      :..:||..:|.||:|.:|... 
  Fly   161 HGMYECQVSTPTG------IISHFV-NLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQ 218

  Fly   253 -VKWFHHGLPVALGAHSTTHESELQTNRSVDHYVNAVRHM-------------LVVKSVRNADMG 303
             |.|                    |.|..:.:||::.|.:             |:::..:..|.|
  Fly   219 YVYW--------------------QKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSG 263

  Fly   304 QYECRASN 311
            .|.|.|||
  Fly   264 NYTCSASN 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 IG_like 41..118 CDD:214653 7/27 (26%)
Ig strand B 52..56 CDD:409353
Ig strand C 64..68 CDD:409353
Ig strand E 94..98 CDD:409353 1/3 (33%)
Ig strand F 108..113 CDD:409353 1/4 (25%)
Ig strand G 122..125 CDD:409353 0/2 (0%)
Ig 133..219 CDD:472250 24/110 (22%)
Ig strand B 150..154 CDD:409353 0/3 (0%)
Ig strand C 163..167 CDD:409353 1/10 (10%)
Ig strand E 183..187 CDD:409353 1/13 (8%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
Ig strand G 211..214 CDD:409353 0/2 (0%)
Ig_3 222..311 CDD:464046 22/109 (20%)
FN3 339..431 CDD:238020
dpr12NP_652462.3 IG_like 86..183 CDD:214653 21/103 (20%)
Ig strand B 95..99 CDD:409353 0/3 (0%)
Ig strand C 109..117 CDD:409353 1/7 (14%)
Ig strand E 149..153 CDD:409353 1/3 (33%)
Ig strand F 163..168 CDD:409353 2/4 (50%)
Ig strand G 176..179 CDD:409353 1/2 (50%)
Ig_3 195..271 CDD:464046 20/95 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.