DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and dpr10

DIOPT Version :10

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:111 Identity:35/111 - (31%)
Similarity:50/111 - (45%) Gaps:12/111 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 HVLFSPEVSIPQPVVYTKL-GSRAHLECIVEAAPAATVKWF-HHGLPV-ALGAHSTTHESELQT- 277
            |....|...:..|...|.| |..|:|.|.|:.....||.|. |..|.: .:|.::.|.:...|| 
  Fly    48 HKWNEPYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTS 112

  Fly   278 -NRSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQISVKSGSVEL 322
             :|.:|.:.      |.:|..:..|.|.|||:.|.| .|:|.||.|
  Fly   113 YHRDIDEWT------LQIKWAQQRDAGVYECQISTQ-PVRSYSVNL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 IG_like 41..118 CDD:214653
Ig strand B 52..56 CDD:409353
Ig strand C 64..68 CDD:409353
Ig strand E 94..98 CDD:409353
Ig strand F 108..113 CDD:409353
Ig strand G 122..125 CDD:409353
Ig 133..219 CDD:472250 1/1 (100%)
Ig strand B 150..154 CDD:409353
Ig strand C 163..167 CDD:409353
Ig strand E 183..187 CDD:409353
Ig strand F 197..202 CDD:409353
Ig strand G 211..214 CDD:409353
Ig_3 222..311 CDD:464046 27/93 (29%)
FN3 339..431 CDD:238020
dpr10NP_729591.1 Ig 53..138 CDD:472250 26/90 (29%)
Ig strand B 71..75 CDD:409371 2/3 (67%)
Ig strand E 120..124 CDD:409371 1/9 (11%)
Ig_3 214..287 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.