DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wrapper and Hmcn1

DIOPT Version :10

Sequence 1:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001258221.1 Gene:Hmcn1 / 289094 RGDID:1564772 Length:5635 Species:Rattus norvegicus


Alignment Length:396 Identity:107/396 - (27%)
Similarity:153/396 - (38%) Gaps:71/396 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ENDTVQLPCTLN-TPFRYVRWHRDDVALVDSRHPELPPPDRIMLWPNGSLQVANVQSSDTGDYYC 111
            ||..|.|||..: .|...:.|.||.|.|.:..       .:....|.|.|.:.||...|.|.|.|
  Rat  4182 ENSQVVLPCVADGIPTPAIHWERDSVLLANLL-------GKYTAQPYGELVLENVVLEDAGTYTC 4239

  Fly   112 EMNSDSGHVVQQHAIEVQLAPQVLIEPSDLTEQRIGAIFEVVCEAQGVPQPVITWRLNGNVIQPQ 176
            ..|:.:|.......:.|...|.....|.||:..: |....:.|:|.|:|.|.:||..|.|:|...
  Rat  4240 VANNAAGEDTHTVTLTVHALPTFTELPGDLSLNK-GEQLRLSCKAVGIPLPKLTWTFNNNIIPAH 4303

  Fly   177 SNTGNRQS-LILEIKSRNQAGLIECVASNGVG-EPAVANVYLHVLFSPEVSIPQPVVY------- 232
            .::.|..| |::|..|:..:|...|.|.|.|| ..|:..||          :.:|.|:       
  Rat  4304 FDSVNGHSELVIEKVSKEDSGTYVCTAENSVGFVKAIGFVY----------VKEPPVFKGDYPSN 4358

  Fly   233 --TKLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTTHESELQTNRSVDHYVNAVRHMLVVK 295
              ..||..|.|.|.|:..||.|::|...|..|.:     :|......|.|           |.:.
  Rat  4359 WIEPLGGNAILNCEVKGDPAPTIQWSRKGADVEI-----SHRIRQLGNGS-----------LAIY 4407

  Fly   296 SVRNADMGQYECRASNQISV--KSGSVELTGRPMPCLFKINPGTQSSTSHVLVWQTE-SLLPIME 357
            ...|.|.|.|.|.|:|:..|  :|.|:.|...||..|..:.....:.....|..|.. ...|.:.
  Rat  4408 GTVNEDAGDYTCVAANEAGVVERSMSLTLQSSPMITLEPVETIVDAGGRVTLDCQAAGEPQPTIT 4472

  Fly   358 FKLKFRQIPSNNVTRQVRTNWTELTIPAQATNGLIYITTYTLHGLQPASLYEVSVLARNSFGWSD 422
            :..:.|.||.:|          .||:   ..|..:||....   .:..|.||  .:|||..|   
  Rat  4473 WSRQGRPIPWDN----------RLTM---LPNSSLYIAAAR---KEDTSEYE--CVARNLMG--- 4516

  Fly   423 NSKIVR 428
             |.:||
  Rat  4517 -SVLVR 4521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wrapperNP_477404.1 IG_like 41..118 CDD:214653 22/70 (31%)
Ig strand B 52..56 CDD:409353 2/3 (67%)
Ig strand C 64..68 CDD:409353 0/3 (0%)
Ig strand E 94..98 CDD:409353 2/3 (67%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
Ig strand G 122..125 CDD:409353 0/2 (0%)
Ig 133..219 CDD:472250 28/87 (32%)
Ig strand B 150..154 CDD:409353 0/3 (0%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand E 183..187 CDD:409353 2/4 (50%)
Ig strand F 197..202 CDD:409353 1/4 (25%)
Ig strand G 211..214 CDD:409353 0/2 (0%)
Ig_3 222..311 CDD:464046 24/97 (25%)
FN3 339..431 CDD:238020 22/91 (24%)
Hmcn1NP_001258221.1 ChlD <30..210 CDD:440853
Ig 520..608 CDD:472250
Ig strand B 537..541 CDD:409353
Ig strand C 550..554 CDD:409353
Ig strand E 574..578 CDD:409353
Ig strand F 588..593 CDD:409353
Ig strand G 601..604 CDD:409353
I-set 612..696 CDD:400151
Ig strand B 629..633 CDD:409353
Ig strand C 642..646 CDD:409353
Ig strand E 665..668 CDD:409353
Ig strand F 678..683 CDD:409353
Ig strand G 693..696 CDD:409353
I-set 702..789 CDD:400151
Ig strand B 720..723 CDD:409353
Ig strand C 732..736 CDD:409353
Ig strand E 755..759 CDD:409353
Ig strand F 769..774 CDD:409353
Ig 793..884 CDD:472250
Ig strand B 810..814 CDD:409570
Ig strand C 823..829 CDD:409570
Ig strand E 850..854 CDD:409570
Ig strand F 864..869 CDD:409570
Ig strand G 877..880 CDD:409570
Ig 890..977 CDD:472250
Ig strand B 907..911 CDD:409353
Ig strand C 921..925 CDD:409353
Ig strand F 957..962 CDD:409353
Ig strand G 970..973 CDD:409353
Ig 980..1071 CDD:472250
Ig strand B 998..1002 CDD:409353
Ig strand C 1011..1015 CDD:409353
Ig strand E 1035..1038 CDD:409353
Ig strand F 1048..1053 CDD:409353
Ig strand G 1061..1064 CDD:409353
I-set 1085..1167 CDD:400151
Ig strand B 1097..1101 CDD:409353
Ig strand C 1110..1114 CDD:409353
Ig strand E 1133..1137 CDD:409353
Ig strand F 1147..1152 CDD:409353
Ig strand G 1160..1163 CDD:409353
I-set 1171..1258 CDD:400151
Ig strand B 1188..1192 CDD:409353
Ig strand C 1201..1205 CDD:409353
Ig strand E 1224..1228 CDD:409353
Ig strand F 1238..1243 CDD:409353
Ig strand G 1251..1254 CDD:409353
Ig 1262..1355 CDD:472250
Ig strand B 1284..1288 CDD:409570
Ig strand C 1297..1301 CDD:409570
Ig strand E 1320..1324 CDD:409570
Ig strand F 1335..1340 CDD:409570
Ig strand G 1348..1351 CDD:409570
I-set 1368..1448 CDD:400151
Ig strand B 1378..1382 CDD:409353
Ig strand C 1391..1395 CDD:409353
Ig strand E 1414..1418 CDD:409353
Ig strand F 1428..1433 CDD:409353
Ig strand G 1441..1444 CDD:409353
Ig_3 1451..1529 CDD:464046
I-set 1563..1633 CDD:400151
Ig strand B 1565..1569 CDD:409353
Ig strand C 1578..1582 CDD:409353
Ig strand E 1601..1605 CDD:409353
Ig strand F 1615..1620 CDD:409353
I-set 1645..1729 CDD:400151
Ig strand B 1659..1663 CDD:409353
Ig strand C 1672..1676 CDD:409353
Ig strand E 1694..1699 CDD:409353
Ig strand F 1709..1714 CDD:409353
I-set 1752..1822 CDD:400151
Ig strand C 1765..1769 CDD:409353
Ig strand E 1788..1792 CDD:409353
Ig strand F 1802..1807 CDD:409353
IG_like 1834..1915 CDD:214653
Ig strand B 1844..1848 CDD:409568
Ig strand C 1857..1861 CDD:409568
Ig strand E 1881..1885 CDD:409568
Ig strand F 1895..1900 CDD:409568
Ig strand G 1908..1911 CDD:409568
Ig 1928..2000 CDD:472250
Ig strand B 1938..1942 CDD:409353
Ig strand C 1951..1955 CDD:409353
Ig strand E 1974..1978 CDD:409353
Ig strand F 1988..1993 CDD:409353
Ig_3 2011..2087 CDD:464046
I-set 2111..2191 CDD:400151
Ig strand B 2121..2125 CDD:409570
Ig strand C 2134..2138 CDD:409570
Ig strand E 2156..2160 CDD:409570
Ig strand F 2171..2176 CDD:409570
Ig strand G 2184..2187 CDD:409570
Ig_3 2194..2273 CDD:464046
Ig_3 2297..2367 CDD:464046
I-set 2392..2474 CDD:400151
Ig strand B 2404..2408 CDD:409568
Ig strand C 2417..2421 CDD:409568
Ig strand E 2438..2444 CDD:409568
Ig strand F 2454..2459 CDD:409568
I-set 2478..2567 CDD:400151
Ig strand B 2497..2501 CDD:409353
Ig strand C 2510..2514 CDD:409353
Ig strand E 2533..2537 CDD:409353
Ig strand F 2547..2552 CDD:409353
I-set 2582..2663 CDD:400151
Ig strand B 2593..2597 CDD:409353
Ig strand C 2606..2610 CDD:409353
Ig strand E 2629..2633 CDD:409353
Ig strand F 2643..2648 CDD:409353
Ig strand G 2656..2659 CDD:409353
I-set 2681..2762 CDD:400151
Ig strand B 2692..2696 CDD:409353
Ig strand C 2705..2709 CDD:409353
Ig strand E 2727..2732 CDD:409353
Ig strand F 2742..2747 CDD:409353
I-set 2789..2858 CDD:400151
Ig strand B 2795..2799 CDD:409353
Ig strand C 2808..2812 CDD:409353
Ig strand E 2831..2835 CDD:409353
Ig strand F 2845..2850 CDD:409353
I-set 2879..2960 CDD:400151
Ig strand B 2890..2894 CDD:409353
Ig strand C 2903..2907 CDD:409353
Ig strand E 2925..2930 CDD:409353
Ig strand F 2940..2945 CDD:409353
I-set 2982..3052 CDD:400151
Ig strand B 2982..2986 CDD:409353
Ig strand C 2995..2999 CDD:409353
Ig strand E 3018..3022 CDD:409353
Ig strand F 3032..3037 CDD:409353
I-set 3069..3147 CDD:400151
Ig strand B 3077..3081 CDD:409353
Ig strand C 3090..3094 CDD:409353
Ig strand E 3113..3117 CDD:409353
Ig strand F 3127..3132 CDD:409353
Ig strand G 3140..3143 CDD:409353
Ig_3 3150..3228 CDD:464046
Ig 3244..3338 CDD:472250
Ig strand B 3264..3268 CDD:409353
Ig strand C 3277..3281 CDD:409353
Ig strand E 3302..3306 CDD:409353
Ig strand F 3316..3321 CDD:409353
Ig strand G 3329..3332 CDD:409353
I-set 3354..3430 CDD:400151
Ig strand B 3360..3364 CDD:409353
Ig strand C 3373..3377 CDD:409353
Ig strand E 3396..3400 CDD:409353
Ig strand F 3410..3415 CDD:409353
Ig strand G 3423..3426 CDD:409353
Ig 3441..3523 CDD:472250
Ig strand B 3453..3457 CDD:409353
Ig strand C 3466..3470 CDD:409353
Ig strand E 3488..3493 CDD:409353
Ig strand F 3503..3508 CDD:409353
Ig strand G 3516..3519 CDD:409353
Ig 3533..3606 CDD:472250
Ig strand B 3546..3550 CDD:409353
Ig strand C 3559..3563 CDD:409353
Ig strand E 3581..3586 CDD:409353
Ig strand F 3596..3601 CDD:409353
I-set 3629..3709 CDD:400151
Ig strand B 3639..3643 CDD:409353
Ig strand C 3652..3656 CDD:409353
Ig strand E 3674..3679 CDD:409353
Ig strand F 3689..3694 CDD:409353
Ig strand G 3702..3705 CDD:409353
Ig_3 3712..3787 CDD:464046
Ig 3823..3884 CDD:409353
Ig strand C 3834..3838 CDD:409353
Ig strand E 3859..3863 CDD:409353
Ig strand F 3873..3878 CDD:409353
Ig 3899..3984 CDD:472250
Ig strand B 3914..3918 CDD:409353
Ig strand C 3927..3931 CDD:409353
Ig strand E 3950..3954 CDD:409353
Ig strand F 3964..3969 CDD:409353
Ig strand G 3977..3980 CDD:409353
Ig_3 3987..4062 CDD:464046
I-set 4089..4165 CDD:400151
Ig strand B 4096..4100 CDD:409353
Ig strand C 4109..4113 CDD:409353
Ig strand E 4131..4135 CDD:409353
Ig strand F 4145..4150 CDD:409353
Ig strand G 4158..4161 CDD:409353
Ig_3 4168..4243 CDD:464046 21/67 (31%)
I-set 4260..4345 CDD:400151 29/95 (31%)
Ig strand B 4277..4281 CDD:409353 0/3 (0%)
Ig strand C 4290..4294 CDD:409353 1/3 (33%)
Ig strand E 4311..4315 CDD:409353 2/3 (67%)
Ig strand F 4325..4330 CDD:409353 1/4 (25%)
Ig 4356..4435 CDD:472250 26/94 (28%)
Ig strand B 4367..4371 CDD:409353 2/3 (67%)
Ig strand C 4380..4384 CDD:409353 1/3 (33%)
Ig strand E 4402..4406 CDD:409353 2/14 (14%)
Ig strand F 4416..4421 CDD:409353 2/4 (50%)
Ig strand G 4429..4432 CDD:409353 0/2 (0%)
Ig 4441..4526 CDD:472250 24/103 (23%)
Ig strand B 4457..4461 CDD:409353 1/3 (33%)
Ig strand C 4470..4474 CDD:409353 0/3 (0%)
Ig strand E 4492..4496 CDD:409353 0/3 (0%)
Ig strand F 4506..4511 CDD:409353 2/6 (33%)
Ig strand G 4519..4522 CDD:409353 2/3 (67%)
TSP1 4533..4584 CDD:214559
TSP1 4589..4641 CDD:214559
TSP1 4646..4698 CDD:214559
TSP1 4703..4755 CDD:214559
TSP1 4760..4812 CDD:214559
TSP1 4817..4869 CDD:214559
G2F 4868..5092 CDD:214774
EGF_CA 5107..5146 CDD:214542
EGF_CA 5147..5174 CDD:429571
EGF_CA 5192..5229 CDD:214542
EGF_CA 5230..5263 CDD:238011
EGF_CA 5272..5303 CDD:429571
EGF_CA 5315..5354 CDD:214542
EGF_CA 5432..5471 CDD:214542
EGF_CA 5472..5508 CDD:214542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.