DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rtf1 and RTF1

Sequence 1:NP_001286717.1 Gene:Rtf1 FlyBaseID:FBgn0034722 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_011270.1 Gene:RTF1 SGDID:S000003213 Length:558 Species:Saccharomyces cerevisiae

Alignment Length:620 Identity:146/621 (24%)
Similarity:254/621 (41%) Gaps:144/621 (23%)


  Fly    86 DDSQDERQPARQSPAQTQQEHKPPEQASQPAQLSEQEEGEVSDSDSDKSKSNSSSSGSDSSSSSS 150
            |:|::|.|....:.|:..:.:  .:..|:..::   |.|.|.|.|.:...:..|...:|..|...
Yeast    15 DESEEEDQVLTTTSAKRAKNN--DQSLSKKRRI---EVGSVEDDDEEDDYNPYSVGNADYGSEEE 74

  Fly   151 SSDSEFDDGFDDDLMG---DDEDRRRLNGLSEKERETEIYKRIEQREIMRTRWEIERKLKLAR-R 211
            ...:.|      .|.|   |:.||..|..|.|.||||.::   |:.:||: ::: ||||..|| |
Yeast    75 EEANPF------PLEGKYKDESDREHLESLPEMERETLLF---ERSQIMQ-KYQ-ERKLFRARGR 128

  Fly   212 GEKNQEKSKNKGERAKKKKEKREKKARKAREAQAPLPTQASTSTLLDVEPKPSNEVRSASPLSTP 276
            ..|.|:      :|||..::.|:              |:|||                       
Yeast   129 DMKEQQ------QRAKNDEDSRK--------------TRAST----------------------- 150

  Fly   277 ALNRDAASTSAAVASIMPDDAASSAGVSDYFDHKERSKERKKNVEANKTDDKRSNAMALLKAKRE 341
                  .||.|             .|.||                              :||.:.
Yeast   151 ------RSTHA-------------TGHSD------------------------------IKASKL 166

  Fly   342 GKAKREEEEAKRMAEKDRDDDKEELDSVSGCKSAVKLKASEIYSDDSGSSDWDEEE-KPAGKRSR 405
            .:.|::.....|....:.|:|.|| |           ...|.|.||.||...|:|| .|..:|..
Yeast   167 SQLKKQRARKNRHYSDNEDEDDEE-D-----------YREEDYKDDEGSEYGDDEEYNPFDRRDT 219

  Fly   406 SNSSKASSESEDEEKAPQRPVFITTREDLNKLRLSRYKMERFVNLPIFESTVLNCFVRISIGNNG 470
            .:..:....:|:|::..:.|..    .|.||||:.|..:.:|...|.||..|..|:.|:::|.:.
Yeast   220 YDKREEVEWAEEEDEQDREPEI----SDFNKLRIGRSFVAKFCFYPGFEDAVKGCYGRVNVGTDK 280

  Fly   471 Q--KPVYRVAEIVGVVETGKIYSLGTTRTNRGLRLKHGTQERVFRLEFISNQEFTENEFNKWNEV 533
            :  |..||:..|..|. ..|.|::|...||:...:..|...:||::.:.|:..|.|:|:.::...
Yeast   281 RTGKTSYRMVRIERVF-LQKPYNMGKFYTNQYFGVTQGKDRKVFQMNYFSDGLFAEDEYQRYLRA 344

  Fly   534 CQQSHVQMPTIDLIAIKQNDIKKALNYEFKDEDVDKIVEEKNRFRNR--PTNYAMKKTCLM-KER 595
            ...|.:..|::..::.|..::...:|....|:..|::|..:.:|..:  .||..::||.|. |.:
Yeast   345 LDNSQMIKPSLHSLSNKTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQ 409

  Fly   596 DAAMLRGDYDIAQDLGQQIDELENRASELDKRRSH---TLNLISYINDRNRK---KNVEDAEKAI 654
            .|.....:.|||: ...|:...|.|.|..:|...:   .:..:..:..:|||   .|:.:||...
Yeast   410 YAKETNNEKDIAK-YSAQLRNFEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVK 473

  Fly   655 LEEARANKGLKISDPFTRRITQPRMGFKGAKKDED 689
            .|:  :|.....||||:|..|:.::.::..:|:|:
Yeast   474 KED--SNNFDSKSDPFSRLKTRTKVYYQEIQKEEN 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rtf1NP_001286717.1 Plus3 428..535 CDD:197843 31/109 (28%)
RTF1NP_011270.1 COG5296 1..558 CDD:227615 146/621 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5296
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002454
OrthoInspector 1 1.000 T1136887
orthoMCL 1 0.900 OOG5_129541
Panther 1 1.100 LDO PTHR13115
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1264
TreeFam 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.