DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rtf1 and VIP5

Sequence 1:NP_001286717.1 Gene:Rtf1 FlyBaseID:FBgn0034722 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_001322666.1 Gene:VIP5 AraportID:AT1G61040 Length:643 Species:Arabidopsis thaliana

Alignment Length:795 Identity:180/796 (23%)
Similarity:312/796 (39%) Gaps:242/796 (30%)


  Fly    60 AGAPSSKKKKRQKPS---RDSSSSESNWD--DDSQDERQPARQSPAQTQQEHKPPEQASQPAQLS 119
            ||..:|..:.|..||   |:.|.|:.:.|  |||.::|..|.:.|:.:|...|...:|.:..: :
plant    12 AGRTNSAGRSRHPPSSRRREGSYSDGSSDSRDDSDEDRGYASRKPSGSQVPLKKRLEAEREDR-A 75

  Fly   120 EQEEGEVSDSDSDKSKSNSSSSGSDSSSSSSSSDSEFDDGFDDDLMGDDEDRRRLNGLSEKERET 184
            .:.||...|..||:           ...||..||      |.|||..::|||::|.|::|.:||.
plant    76 ARVEGGYGDGPSDR-----------EGDSSEESD------FGDDLYKNEEDRQKLAGMTEFQREM 123

  Fly   185 EIYKRIEQREIMRTRWEIERKLKLARRGEKN-QEKSKNKGERAKKKKEKREKKARKAREAQAPLP 248
            .:.:|.:                  ::|:|| .||.::|.|..|....|:|.:         |||
plant   124 ILSERAD------------------KKGDKNFTEKLRSKRESEKTPVSKKETQ---------PLP 161

  Fly   249 TQASTSTLLDVEPKPSNEVRSASPLSTPALNRDAASTSAAVASIMPDDAASSAGVSDYFDHKERS 313
            .              |..|||:           |.|...|.|.   |||.:              
plant   162 A--------------SRGVRSS-----------ARSADRAAAK---DDALN-------------- 184

  Fly   314 KERKKNVEANKTDDKRSNAMALLKAKREGKAKREEEEAKRMAEKDRDDDKEELDSVSGCKSAVKL 378
                                              |..||||.::|               .|...
plant   185 ----------------------------------ELRAKRMKQQD---------------PAALR 200

  Fly   379 KASEIYSDDSGSSDWDE-EEKPAGKRSRSNSSKASSES---------------EDEEKAPQRPVF 427
            |..:.....|||.|:.. :.||....:.|:||::.|:|               .|::::.     
plant   201 KLRDASKGGSGSRDFSSTKRKPLASSNLSSSSQSDSDSRSQSDDEGSNGGMLDSDDDRSD----- 260

  Fly   428 ITTREDLNKLRLSRYKMERFVNLPIFESTVLNCFVRISIGNNGQKPVYRVAEI--VGVVETGKIY 490
            :.|.||:.::.:.|.|:.:::..|.||..::.||||:.||.:...|:||:..:  |...:..|.|
plant   261 VPTFEDVKEVTIRRSKLAKWLMEPFFEELIVGCFVRVGIGRSKSGPIYRLCWVKNVDATDPDKTY 325

  Fly   491 SLGTTRTNRGLRLKHGTQERVFR--LEFISNQEFTENEFNKWNEVCQQSHVQMPTIDLIAIKQND 553
            .|....|::.|.:..|.:....|  :..||:....|.|:.:|....::::.:|||...|:.|:..
plant   326 KLENKTTHKYLNVVWGNETSAARWQMAMISDGHPLEEEYRQWIREVERTNGRMPTKQDISEKKEA 390

  Fly   554 IKKALNYEFKDEDVDKIVEEKNRFRNRPTNYAMKKTCLMKERDAAMLRGDYDIAQDLGQQIDELE 618
            |::..::.:..|.|.::::||.....||.|.|.:|..|.||.:.|..:.|     :.|  ::.::
plant   391 IQRTNSFVYSAETVKQMLQEKKSASVRPMNVAAEKDRLRKELEIAQSKND-----EAG--VERIK 448

  Fly   619 NRASELDKRRS------HTLNLISYINDRNRKKNVEDAEKAILEEARANKGLKISDPFTRRITQP 677
            ::..:||..|:      ..|.| :.:|.:||.:|.::|.:.....|....|....|||:||.|:.
plant   449 SKIKQLDASRNKKGVDKKALKL-AEMNKKNRAENFKNASEVKSITASLKAGEAGYDPFSRRWTRS 512

  Fly   678 RMGFKGAKKDEDDMQLAPLPPPPPGKKRPNEAGTSS----------ASVRSTDS----------- 721
            ...:.|..|.:|..:              |||..::          |.|.:|::           
plant   513 SNYYNGKNKGKDGEE--------------NEAAVAAAVETNGADAGAGVEATEAALEAAAEAGKL 563

  Fly   722 --------KDYSLYSLHDFDIDLDV--------PLPVNTNSVPKP-------ASKPAETVSKR-- 761
                    :......||:|::.|.:        |..|....:.:.       ..:.||...||  
plant   564 IDTRAPIGQGAEHNQLHNFELSLSLTALQKYGGPQGVQKAFMARKQLTEATVGCRVAENDGKRHG 628

  Fly   762 -SLNLEDYKKKRGLI 775
             :|.:.|||::|||:
plant   629 LTLTVSDYKRRRGLL 643

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rtf1NP_001286717.1 Plus3 428..535 CDD:197843 30/111 (27%)
VIP5NP_001322666.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 130 1.000 Inparanoid score I1833
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124213
orthoMCL 1 0.900 OOG5_129541
Panther 1 1.100 LDO PTHR13115
Phylome 1 0.910 0.875 Consistency score
76.970

Return to query results.
Submit another query.