DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rtf1 and NERD

Sequence 1:NP_001286717.1 Gene:Rtf1 FlyBaseID:FBgn0034722 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_179241.4 Gene:NERD AraportID:AT2G16485 Length:1773 Species:Arabidopsis thaliana

Alignment Length:936 Identity:170/937 (18%)
Similarity:320/937 (34%) Gaps:285/937 (30%)


  Fly     7 QSLIDSNSSDSDSESETNLESDL-----------------------------------MSLAKKR 36
            ::::|....|.|.:||.....|:                                   :.|.:.|
plant   352 ETVMDDVKEDVDKDSEAGKSLDIHVPEATEEVDTDVNYGVGIEKEGDGVGGAEEAGQTVDLEEIR 416

  Fly    37 KKPQTAAKSSSRSDSDSDWANNKAGAPSSKKKKRQKPSR--DSSSSESNWDDDSQDERQPARQ-- 97
            ::.|..:|..::.|.......::......|.:.::|...  |.:....|..|.|..:.:..|:  
plant   417 EENQELSKELAQVDETKISEMSEVTETMIKDEDQEKDDNMTDLAEDVENHRDSSVADIEEGREDH 481

  Fly    98 ---SPAQTQQEHKPPE-QASQPAQLSEQEEGEVSDSDSDKS----------KSNSSSSGSDSSSS 148
               ...:||:|....: ..::.|::||:.:..:.|.|.:|.          |::..||.:|....
plant   482 EDMGVTETQKETVLGKVDRTKIAEVSEETDTRIEDEDQEKDDEMTDVAEDVKTHGDSSVADIEEG 546

  Fly   149 SSSSDSEFDDGFDDDLMGD------DEDRRRLNGLSEKERETEIYK---RIEQREIMRTRWEIER 204
            ..|.: |..:..:|.:|.|      :|:.:...|..::.|.|:..|   :.::.::....::...
plant   547 RESQE-EMTETQEDSVMADEEPEEVEEENKSAGGKRKRGRNTKTVKGTGKKKEEDVCFMCFDGGD 610

  Fly   205 KLKLARRG----------EKN----QEKSK----------------------------------- 220
            .:...|||          :::    |.|.|                                   
plant   611 LVLCDRRGCTKAYHPSCVDRDEAFFQTKGKWNCGWHLCSKCEKTATYLCYTCMFSLCKGCAKDAV 675

  Fly   221 ------NKG--ERAKKKKEKREKKARKAREAQAPLPTQAS-----------TSTLLDVEPKPSNE 266
                  |||  |...:..:..|:|.::...||.....:.|           ..|.|.:.|:..::
plant   676 FFCIRGNKGLCETCMETVKLIERKQQEKEPAQLDFNDKTSWEYLFKDYWIDLKTQLSLSPEELDQ 740

  Fly   267 VRSASPLSTPALNRDAASTSAAVASIMPDDAASSAGVSDYFDHKERSKERKKNVEANK---TDDK 328
            .:  .||.....|.....|::..     |........||....|.:::.|.|:..|.|   :.||
plant   741 AK--RPLKGHETNASKQGTASET-----DYVTDGGSDSDSSPKKRKTRSRSKSGSAEKILSSGDK 798

  Fly   329 RSNAMALLKAKRE-----GKAKREEEEAKRMAEKD------------RDDDKE-------ELDSV 369
            ..:...:..|.:|     ...:|.:.....|.|..            ||..::       .|.::
plant   799 NLSDETMEWASKELLDLVVHMRRGDRSFLPMLEVQTLLLAYIKRYNLRDPRRKSQVICDSRLQNL 863

  Fly   370 SGCKSAVK------------LKASEIYSDDSGSSDWDEEE-----------------KPAGKRSR 405
            .| ||.|.            ||..:..:||......|.||                 |...:::|
plant   864 FG-KSHVGHFEMLNLLDSHFLKKEQNQADDIQGDIVDTEEPNHVDVDENLDHPVKSGKDKKRKTR 927

  Fly   406 SNSSKASSESEDEEKAPQRPVFITTREDLNKLRLSRYKMERFV-NLPIFESTVLNCFVRISIGNN 469
            ..:.:...:|..::.|      .....::|.:.|.|..:|..: :...||..|.:.|||:.|..|
plant   928 KKNVRKGRQSNLDDFA------AVDMHNINLIYLRRSLVEDLLEDSTAFEEKVASAFVRLRISGN 986

  Fly   470 GQKPVYRVAEIVGVVETGKIYSLGTTRTNRGLRLKHGTQERVFRLEFISNQEFTENEFNKWNEVC 534
            .::.:||:.::||..:..:.|.:|...|:..|.:.:..:..|..::.||||:|||:|       |
plant   987 QKQDLYRLVQVVGTSKAPEPYKVGKKTTDYVLEILNLDKTEVISIDIISNQDFTEDE-------C 1044

  Fly   535 QQSHVQMPTIDLIAIKQNDIKKALNYEFKDEDVDKIVEEKNRFRNRPTNYAMKKTCLMKERDAAM 599
            ::            :||: ||..|.......|    ::||        ..|:::..:....:|.:
plant  1045 KR------------LKQS-IKCGLINRLTVGD----IQEK--------AIALQEVRVKNLLEAEI 1084

  Fly   600 LRGDYDIAQDLGQQIDELENRASELDKRRSHTLNLISYINDRNRKKNVEDAEKAILEEARANKGL 664
            ||            ...|.:|||::.:|:.:.. |:...|........|..||..|        |
plant  1085 LR------------FSHLRDRASDMGRRKEYPY-LLKLSNSLTMLTLRECVEKLQL--------L 1128

  Fly   665 KISDPFTRRITQ-------PRMGFKGAKKDED-------DMQLAPLP-----------PPPPGKK 704
            |..:...||:.:       |:|......:|||       :.||.|..           .|..|..
plant  1129 KSPEERQRRLEEIPEIHADPKMDPDCESEDEDEKEEKEKEKQLRPRSSSFNRRGRDPISPRKGGF 1193

  Fly   705 RPNEAGTSSASVRSTD-----SKDYS 725
            ..||:.|.:::..:|.     |:.||
plant  1194 SSNESWTGTSNYSNTSANRELSRSYS 1219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rtf1NP_001286717.1 Plus3 428..535 CDD:197843 30/108 (28%)
NERDNP_179241.4 PHD5_NSD 601..646 CDD:277043 6/45 (13%)
SWIB 809..882 CDD:280380 11/74 (15%)
Plus3 944..1052 CDD:197843 33/128 (26%)
GYF 1308..1363 CDD:214666
zf-CCCH 1748..1772 CDD:279036
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13115
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.