DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rtf1 and Rtf1

Sequence 1:NP_001286717.1 Gene:Rtf1 FlyBaseID:FBgn0034722 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_084388.2 Gene:Rtf1 MGIID:1309480 Length:715 Species:Mus musculus

Alignment Length:808 Identity:308/809 (38%)
Similarity:447/809 (55%) Gaps:176/809 (22%)


  Fly     3 KRRTQSLIDSNSSDSDSESETNLESDLMSLAKKR------KKP---QTAAKSSSR-SDSDSDWA- 56
            ||:.:.:|||::.||.|:.  ||:.:|:||||::      |:|   |.||.|.|. ||||.:|. 
Mouse    49 KRKGRVVIDSDTEDSGSDE--NLDQELLSLAKRKRSDSEEKEPPVSQPAASSDSETSDSDDEWTF 111

  Fly    57 ----NNKAGAPSS-KKKKRQKPSRDSSSSESNWDDDSQDERQPARQSPAQTQQEHKPPEQASQPA 116
                |.|.|.... :||...|...:.::|..:.|.||.                          |
Mouse   112 GSNKNKKKGKTRKVEKKGAMKKQANKAASSGSSDRDSS--------------------------A 150

  Fly   117 QLSEQEEGEVSDSDSDKSKSNSSSSGSDSSSSSSSSDSEFDDGFDDDLMGDDEDRRRLNGLSEKE 181
            :.|..||||||||:       ||||.|.|.|.|||.|.||.||:.:|||||:|||.||..::|||
Mouse   151 ESSAPEEGEVSDSE-------SSSSSSSSDSDSSSEDEEFHDGYGEDLMGDEEDRARLEQMTEKE 208

  Fly   182 RETEIYKRIEQREIMRTRWEIERKLKLARRGEKNQEKSKNKGERAKKKKEKREKKARKAREAQAP 246
            ||.|::.|||:||:::.|:||::|||.|::.||.::|.       |:::|:.:||..:.:|:|. 
Mouse   209 REQELFNRIEKREVLKRRFEIKKKLKTAKKKEKKEKKK-------KQEEEQEKKKLTQIQESQV- 265

  Fly   247 LPTQASTSTLLDVEPKPSNEVRSASPLSTPALNRDAASTSAAVASIMPDDAASSAGVSDYFDHKE 311
                                                  ||                     .:||
Mouse   266 --------------------------------------TS---------------------HNKE 271

  Fly   312 RSKERKKNVEANKTDDKRSNAMALLKAKREGKAKREEEEAKRMAEKDRDDDKEELDSVSGCKSAV 376
            |..:|.:.:      ||:|.||..|||:||   ||:...|:.:|:|.                  
Mouse   272 RRSKRDEKL------DKKSQAMEELKAERE---KRKNRTAELLAKKQ------------------ 309

  Fly   377 KLKASEIYSDDSGSSDWDEEEKPAGKRSRSNSSKASSESEDEEKAPQRPVFITTREDLNKLRLSR 441
            .||.||:||||....|   ::|.:.|..||:.:.:|.|.|::|:.|.:...::..|:||::||||
Mouse   310 PLKTSEVYSDDEEEED---DDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELNRVRLSR 371

  Fly   442 YKMERFVNLPIFESTVLNCFVRISIGNNGQKPVYRVAEIVGVVETGKIYSLGTTRTNRGLRLKHG 506
            :|:||:.::|.|..||..|||||.|||:..|||||||||.|||||.|:|.||.||||:||:|:||
Mouse   372 HKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHG 436

  Fly   507 TQERVFRLEFISNQEFTENEFNKWNEVCQQSHVQMPTIDLIAIKQNDIKKALNYEFKDEDVDKIV 571
            ..:|||||||:|||||||:||.||.|....:.:|:||:|.|..|:..||:||||:|.|:|:::||
Mouse   437 NDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEALNYKFNDQDIEEIV 501

  Fly   572 EEKNRFRNRPTNYAMKKTCLMKERDAAMLRGDYDIAQDLGQQIDELENRASELDKRRSHTLNLIS 636
            :||.|||..|.|||||||.|:||:..|...||.|.|:.:..|::|||.||..||::|:..::.||
Mouse   502 KEKERFRKAPPNYAMKKTQLLKEKAMAEDLGDQDKAKQIQDQLNELEERAEALDRQRTKNISAIS 566

  Fly   637 YINDRNRKKNVEDAEKAILEEARANKGLKISDPFTRRITQPRMGFKGAKKDEDDMQLA------- 694
            |||.|||:.|:.::|||::.|:...:..:: ||||||..:|.:   .:...:..:|.|       
Mouse   567 YINQRNREWNIVESEKALVAESHNMRNQQM-DPFTRRQCKPTI---VSNSRDPAVQAAILAQLNA 627

  Fly   695 -----PLPPPP----PGKKRPNEAGTSSASVRSTDSKDYSLYSLHDFDIDLDVPLPVNTNSVPKP 750
                 .||..|    .|:.:..:..:.:||..|.|     |:.:||||:.:|:.:|.:.:.....
Mouse   628 KYGSGVLPDAPKEMSKGQGKDKDLNSKTASDLSED-----LFKVHDFDVKIDLQVPSSESKALAI 687

  Fly   751 ASK--PA-ETVSKRSLNLEDYKKKRGLI 775
            .||  || :...:||||||||||:||||
Mouse   688 TSKAPPAKDGAPRRSLNLEDYKKRRGLI 715

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rtf1NP_001286717.1 Plus3 428..535 CDD:197843 68/107 (64%)
Rtf1NP_084388.2 COG5296 194..628 CDD:227615 175/434 (40%)
Plus-3 364..462 CDD:281165 30/98 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5296
Hieranoid 1 1.000
Homologene 1 1.000 H133868
Inparanoid 1 1.050 415 1.000 Inparanoid score I1811
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002454
OrthoInspector 1 1.000 T1085487
orthoMCL 1 0.900 OOG5_129541
Panther 1 1.100 LDO PTHR13115
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1264
TreeFam 1 0.960
1110.950

Return to query results.
Submit another query.