DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rtf1 and rtf1

Sequence 1:NP_001286717.1 Gene:Rtf1 FlyBaseID:FBgn0034722 Length:775 Species:Drosophila melanogaster
Sequence 2:XP_012823707.1 Gene:rtf1 XenbaseID:XB-GENE-993328 Length:677 Species:Xenopus tropicalis

Alignment Length:822 Identity:315/823 (38%)
Similarity:449/823 (55%) Gaps:197/823 (24%)


  Fly     3 KRRTQSLIDSNSSDSDSESETNLESDLMSLAKKRK-----------KPQTAAKSSSRSDSDSDWA 56
            ||:.:.:|||::.||.|:.  ||:.:|:||||:::           || .|...|..||||.:|.
 Frog     4 KRKGRVVIDSDTEDSGSDE--NLDQELLSLAKRKRSDSEEKEQPISKP-AATSDSETSDSDDEWT 65

  Fly    57 ------NNKAGAP---SSKKKKRQKPSRDSSSSESNWDDDSQDERQPARQSPAQTQQEHKPPEQA 112
                  |.|.|.|   ..||...:|.:..::||.|:..|.|::...|                  
 Frog    66 VTGQSKNKKKGKPGKGGEKKAAMKKQANRAASSASSGKDSSEESSAP------------------ 112

  Fly   113 SQPAQLSEQEEGEVSDSDSDKSKSNSSSSGSDSSSSSSSSDSEFDDGFDDDLMGDDEDRRRLNGL 177
                     |||||||||     ||||||.||  |.|||.|.||.||:.:|.|||:|||.||..:
 Frog   113 ---------EEGEVSDSD-----SNSSSSSSD--SDSSSEDEEFCDGYGEDFMGDEEDRARLEQM 161

  Fly   178 SEKERETEIYKRIEQREIMRTRWEIERKLKLARRGEKNQEKSKNKGERAKKKKEKREKKARKARE 242
            :|||||.|::.|||:||:::.|:||::|||.|:|.|| :||.|.|    |..:|:.:||..:..|
 Frog   162 TEKEREQELFNRIEKREVLKRRFEIKKKLKTAKRKEK-KEKEKKK----KHDEEQEKKKQTQVLE 221

  Fly   243 AQAPLPTQASTSTLLDVEPKPSNEVRSASPLSTPALNRDAASTSAAVASIMPDDAASSAGVSDYF 307
            ||..:.:.                                                         
 Frog   222 AQLQVTSH--------------------------------------------------------- 229

  Fly   308 DHKERSKERKKNVEANKTDDKRSNAMALLKAKREGKAKREEEEAKRMAEKDRDDDKEELDSVSGC 372
             :|||..:|.:.:      ||:|.||..|:|:||   ||:.:.|:.:|.|.              
 Frog   230 -NKERRSKRDEKL------DKKSQAMEELRAERE---KRKNKTAELIARKQ-------------- 270

  Fly   373 KSAVKLKASEIYSDDSGSSDWDEEEKPAGKRSRSNSSKASSESEDEE--KAPQRPVFITTREDLN 435
                .||.||:||||   .:.:|::|.:.|.:||:.|.:||: ||||  :.|.:.:.::..|:||
 Frog   271 ----PLKTSEVYSDD---EEEEEDDKSSEKSNRSSRSSSSSD-EDEETVEIPPKSLPVSLPEELN 327

  Fly   436 KLRLSRYKMERFVNLPIFESTVLNCFVRISIGNNGQKPVYRVAEIVGVVETGKIYSLGTTRTNRG 500
            |:||||:|:||:.::|.|..||..|||||.|||:..|||||||||.|||||||:|.||.||||:|
 Frog   328 KVRLSRHKLERWCHMPFFAKTVSGCFVRIGIGNHNSKPVYRVAEITGVVETGKVYQLGGTRTNKG 392

  Fly   501 LRLKHGTQERVFRLEFISNQEFTENEFNKWNEVCQQSHVQMPTIDLIAIKQNDIKKALNYEFKDE 565
            |:|:||..:|||||||:|||||||:||.||.|....:.:|:||:|.|..|:..||:|:||:|.|:
 Frog   393 LQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEAMNYKFNDQ 457

  Fly   566 DVDKIVEEKNRFRNRPTNYAMKKTCLMKERDAAMLRGDYDIAQDLGQQIDELENRASELDKRRSH 630
            |:::||:||.|||..|.|||||||.|||::..|...||.|.|:.:..:::|||.||..||::|:.
 Frog   458 DIEEIVKEKERFRKAPPNYAMKKTQLMKDKAMAEEAGDQDRAKQIQDELNELEERAEALDRQRTK 522

  Fly   631 TLNLISYINDRNRKKNVEDAEKAILEEARANKGLKISDPFTRRITQPRM---------------- 679
            .::.|||||.|||:.|:.::|||::.|:::.|..:: ||||||..:|.|                
 Frog   523 NISAISYINQRNREWNIVESEKALVAESQSMKQQQM-DPFTRRQCKPTMVSNSRDPAVQAAIIAQ 586

  Fly   680 --------GFKGAKKDEDDMQLAPLPPPPPGKKRPNEAGTSSASVRSTDSKDYSLYSLHDFDIDL 736
                    ....|.||....|           .:..:..|.|||..|.|     |:.:||||:.:
 Frog   587 LNAKYGSGASNDASKDTGSAQ-----------SKDKDGNTKSASDLSED-----LFKVHDFDVKI 635

  Fly   737 DVPLPVNTNSVPKPASK--PA-ETVSKRSLNLEDYKKKRGLI 775
            |:.:|.:.:.....:||  || :...:||||||||||:||||
 Frog   636 DLQVPSSESKSLAISSKAPPAKDGAPRRSLNLEDYKKRRGLI 677

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rtf1NP_001286717.1 Plus3 428..535 CDD:197843 70/107 (65%)
rtf1XP_012823707.1 COG5296 151..590 CDD:227615 214/534 (40%)
Plus-3 326..424 CDD:281165 68/98 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5296
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H133868
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002454
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1264
TreeFam 1 0.960
76.810

Return to query results.
Submit another query.