DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rtf1 and Rtf1

Sequence 1:NP_001286717.1 Gene:Rtf1 FlyBaseID:FBgn0034722 Length:775 Species:Drosophila melanogaster
Sequence 2:XP_006234845.1 Gene:Rtf1 RGDID:1310654 Length:715 Species:Rattus norvegicus

Alignment Length:808 Identity:314/809 (39%)
Similarity:451/809 (56%) Gaps:175/809 (22%)


  Fly     3 KRRTQSLIDSNSSDSDSESETNLESDLMSLAKKR------KKP---QTAAKSSSR-SDSDSDWA- 56
            ||:.:.:|||::.||.|:.  ||:.:|:||||::      |:|   |.||.|.|. ||||.:|. 
  Rat    48 KRKGRVVIDSDTEDSGSDE--NLDQELLSLAKRKRSDSEEKEPPVSQPAASSDSETSDSDDEWTF 110

  Fly    57 ----NNKAG-APSSKKKKRQKPSRDSSSSESNWDDDSQDERQPARQSPAQTQQEHKPPEQASQPA 116
                |.|.| |...:||...|...:.::|..:.|.||.                          |
  Rat   111 GSNKNKKKGKARKVEKKGAMKKQANKAASSGSSDRDSS--------------------------A 149

  Fly   117 QLSEQEEGEVSDSDSDKSKSNSSSSGSDSSSSSSSSDSEFDDGFDDDLMGDDEDRRRLNGLSEKE 181
            :.|..|||||||||     ||||||.|| |.||||.|.||.||:.:|||||:|||.||..::|||
  Rat   150 ESSAPEEGEVSDSD-----SNSSSSSSD-SDSSSSEDEEFHDGYGEDLMGDEEDRARLEQMTEKE 208

  Fly   182 RETEIYKRIEQREIMRTRWEIERKLKLARRGEKNQEKSKNKGERAKKKKEKREKKARKAREAQAP 246
            ||.|::.|||:||:::.|:||::|||.|::.||.::|.       |:::|:.:||..:.:|:|. 
  Rat   209 REQELFNRIEKREVLKRRFEIKKKLKTAKKKEKKEKKK-------KQEEEQEKKKLTQIQESQV- 265

  Fly   247 LPTQASTSTLLDVEPKPSNEVRSASPLSTPALNRDAASTSAAVASIMPDDAASSAGVSDYFDHKE 311
                                                  ||                     .:||
  Rat   266 --------------------------------------TS---------------------HNKE 271

  Fly   312 RSKERKKNVEANKTDDKRSNAMALLKAKREGKAKREEEEAKRMAEKDRDDDKEELDSVSGCKSAV 376
            |..:|.:.:      ||:|.||..|||:||   ||:...|:.:|:|.                  
  Rat   272 RRSKRDEKL------DKKSQAMEELKAERE---KRKNRTAELLAKKQ------------------ 309

  Fly   377 KLKASEIYSDDSGSSDWDEEEKPAGKRSRSNSSKASSESEDEEKAPQRPVFITTREDLNKLRLSR 441
            .||.||:||||....|   ::|.:.|..||:.:.:|.|.|::|:.|.:...::..|:||::||||
  Rat   310 PLKTSEVYSDDEEEED---DDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELNRVRLSR 371

  Fly   442 YKMERFVNLPIFESTVLNCFVRISIGNNGQKPVYRVAEIVGVVETGKIYSLGTTRTNRGLRLKHG 506
            :|:||:.::|.|..||..|||||.|||:..|||||||||.|||||.|:|.||.||||:||:|:||
  Rat   372 HKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHG 436

  Fly   507 TQERVFRLEFISNQEFTENEFNKWNEVCQQSHVQMPTIDLIAIKQNDIKKALNYEFKDEDVDKIV 571
            ..:|||||||:|||||||:||.||.|....:.:|:||:|.|..|:..||:||||:|.|:|:::||
  Rat   437 NDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKEFSIKEALNYKFNDQDIEEIV 501

  Fly   572 EEKNRFRNRPTNYAMKKTCLMKERDAAMLRGDYDIAQDLGQQIDELENRASELDKRRSHTLNLIS 636
            :||.|||..|.|||||||.|:||:..|...||.|.|:.:..|::|||.||..||::|:..::.||
  Rat   502 KEKERFRKAPPNYAMKKTQLLKEKAMAEDLGDQDKAKQIQDQLNELEERAEALDRQRTKNISAIS 566

  Fly   637 YINDRNRKKNVEDAEKAILEEARANKGLKISDPFTRRITQPRMGFKGAKKDEDDMQLA------- 694
            |||.|||:.|:.::|||::.|:...:..:: ||||||..:|.:   .:...:..:|.|       
  Rat   567 YINQRNREWNIVESEKALVAESHNMRNQQM-DPFTRRQCKPTI---VSNSRDPAVQAAILAQLNA 627

  Fly   695 -----PLPPPP----PGKKRPNEAGTSSASVRSTDSKDYSLYSLHDFDIDLDVPLPVNTNSVPKP 750
                 .||..|    .|:.:..:..:.|||..|.|     |:.:||||:.:|:.:|.:.:.....
  Rat   628 KYGSGALPDAPKEVSKGQGKDKDLNSKSASDLSED-----LFKVHDFDVKIDLQVPSSESKALAI 687

  Fly   751 ASK--PA-ETVSKRSLNLEDYKKKRGLI 775
            .||  || :...:||||||||||:||||
  Rat   688 TSKAPPAKDGAPRRSLNLEDYKKRRGLI 715

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rtf1NP_001286717.1 Plus3 428..535 CDD:197843 68/107 (64%)
Rtf1XP_006234845.1 COG5296 194..628 CDD:227615 175/434 (40%)
Plus-3 364..462 CDD:281165 31/98 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5296
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 345 1.000 Inparanoid score I2219
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002454
OrthoInspector 1 1.000 T1089028
orthoMCL 1 0.900 OOG5_129541
Panther 1 1.100 LDO PTHR13115
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.