DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rtf1 and CG31703

Sequence 1:NP_001286717.1 Gene:Rtf1 FlyBaseID:FBgn0034722 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_724376.1 Gene:CG31703 FlyBaseID:FBgn0051703 Length:439 Species:Drosophila melanogaster

Alignment Length:462 Identity:121/463 (26%)
Similarity:201/463 (43%) Gaps:69/463 (15%)


  Fly   311 ERSKERKKNVEANKTDDKRSNAMALLKAKRE---GKAKREEEEAKRMAEKDRDDDKEELDSVSGC 372
            ||.:.|:|.....::..|.::|...|.|.|.   .|.|..|:.|::  .|..||.|.:      .
  Fly     3 ERLRTRRKIANKLESGGKTAHAFERLLAIRTIKLSKGKCSEDSAEQ--TKSSDDCKAQ------T 59

  Fly   373 KSAVKLKASEIYSDDSGSSDWDEEEKPAGKRSRSNSSKASSESEDEEKAPQRPVFITTREDLNKL 437
            :..|.::..|.||.||..:  .|.|..|     .|..:.:.|||:.         ::..|.|::.
  Fly    60 RKDVNIEVKETYSGDSSPN--SESENTA-----QNDPQMNVESEER---------VSNLEQLSRA 108

  Fly   438 RLSRYKMERFVNLPIFESTVLNCFVRISIGNNGQKPVYRVAEIVGVVETGKIYSLGTTRTNRGLR 502
            .|.|..::..:..|||...|:..|||:::|.     ||.:.|.:.:.:..|.|.:...|||..|.
  Fly   109 VLKRNDIKNLLGKPIFAEAVIGSFVRLNVGK-----VYSIYETIALHQDSKDYRVDGKRTNLILV 168

  Fly   503 LKHGTQERVFRLEFISNQEFTENEFNKWNEVCQQSHVQMPTIDLIAIKQNDIKKALNYEFKDEDV 567
            |:.|:::|..|::.:|||..|:.||..|.|...::...:||::.||.||..:|.|..|.:.:.||
  Fly   169 LRCGSEKRYSRIDVVSNQPITQKEFLLWLETNLRNRCTLPTLNDIAKKQVQVKNACKYSYTETDV 233

  Fly   568 DKIVEEKNRFRNRPTNYAMKKTCLMKERDAAMLRGDYDIAQDLGQQIDEL-ENRASELDKRRSHT 631
            :|::::|.. .....|.|.:|..|:.|||.|....|.:..|.|.::|.|: |....:::|...|.
  Fly   234 EKLIQDKKE-AGIKQNAAYRKISLIIERDMAAGMNDVEKVQVLEKKILEIDEEPRPQIEKTGQHR 297

  Fly   632 LNLISYINDRNRKKNVEDAEKAILEEARANKGLKISDPFTRRITQP------------------- 677
            ..::|    ..|..:|....:   .|.....|.|.|  |.:|..:|                   
  Fly   298 YQVLS----STRGVHVPTIYR---HELGVPSGGKSS--FVKRTAKPEQHELEKYMRRKYKKSAVV 353

  Fly   678 -RMGFKGAKKDEDDMQLAPLPPPPPGKKRPNEAGTSSASVRSTDSKDYSLYSLHDFDIDLDVPLP 741
             |..||.|.:|..|............:::..:..|.:.:.:.|: ||.....||.|:|:||    
  Fly   354 SRSRFKKAFEDCVDSSAMVNDIHMESQQKEGDVETETETEKGTE-KDLHSQRLHTFNIELD---- 413

  Fly   742 VNTNSVP 748
             .|..||
  Fly   414 -TTGLVP 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rtf1NP_001286717.1 Plus3 428..535 CDD:197843 33/107 (31%)
CG31703NP_724376.1 Plus-3 105..198 CDD:281165 31/98 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5296
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002454
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13115
RoundUp 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.