DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rtf1 and CG12498

Sequence 1:NP_001286717.1 Gene:Rtf1 FlyBaseID:FBgn0034722 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_570030.1 Gene:CG12498 FlyBaseID:FBgn0040356 Length:261 Species:Drosophila melanogaster

Alignment Length:330 Identity:77/331 (23%)
Similarity:120/331 (36%) Gaps:91/331 (27%)


  Fly   378 LKASEIYSDDSGSSDWDEEEKPAGKRSRSNSSKASSESEDEEKAPQRPVFITTREDLNKLRLSRY 442
            |:||.:..||...|..:..|||                    ..|..||  |:|:.|..|||||:
  Fly    23 LRASPLRIDDENESWVNGYEKP--------------------PTPDLPV--TSRDQLELLRLSRH 65

  Fly   443 KMERFVNLPIFESTVLNCFVRISIGNNGQKPVYRVAEIVGVVETGKIYSLGTTRTNRGLRLKHGT 507
            ::...:..|.||..|..||||:::...|:.|.:|:||::|:.|....|.:....||..|||::..
  Fly    66 RIGLLLVRPAFEQAVTGCFVRVNVSGQGELPDHRIAEVLGICELDFGYKVEQIPTNVALRLRYDD 130

  Fly   508 QERVFRLEFISNQEFTENEFNKWNEVCQQSHVQMPTIDLIAIKQNDIKKALNYEFKDEDVDKIVE 572
            .|....:..:||..||:.||..|.:.|....:..||..::..|:.::..||..|.|..   .:::
  Fly   131 LEMQHEINDVSNLNFTQEEFELWRDNCVNQAISPPTTHILTRKKVELYNALQLEAKPL---SLIQ 192

  Fly   573 EKNRFRNRPTNYAMKKTCLMKERDAAMLRGDYDIAQDLGQQIDELENRASELDKRRSHTLNLISY 637
            ....|..||.                             |:|..:|........:.:|:|..:|.
  Fly   193 RTFSFALRPQ-----------------------------QKIGIMERHGVVYPWQLNHSLPFVSQ 228

  Fly   638 INDRNRKKNVEDAEKAILEEARANKGLKISDPFTRRITQPRMGFKGAKKDEDDMQLAPLPPPPPG 702
            ....|..:...|.                                 ..::||....|||.|    
  Fly   229 SPTENPSRGKADT---------------------------------VDEEEDPGAAAPLLP---- 256

  Fly   703 KKRPN 707
            |..||
  Fly   257 KTEPN 261

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rtf1NP_001286717.1 Plus3 428..535 CDD:197843 38/107 (36%)
CG12498NP_570030.1 Plus3 51..157 CDD:197843 38/108 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5296
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002454
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13115
RoundUp 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.