DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rtf1 and SPBC651.09c

Sequence 1:NP_001286717.1 Gene:Rtf1 FlyBaseID:FBgn0034722 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_595507.1 Gene:SPBC651.09c PomBaseID:SPBC651.09c Length:560 Species:Schizosaccharomyces pombe

Alignment Length:671 Identity:148/672 (22%)
Similarity:267/672 (40%) Gaps:199/672 (30%)


  Fly   125 EVSDSDSDKSKSNSSSSGSDSSSSS-----SSSDSEFDDGFDDD--LMG---DDEDRRRLNGLSE 179
            :|..|.||  :.|:.:.|.|.:..|     ..|:.||::.|.:.  |.|   |:.||.::..::|
pombe    32 DVLSSSSD--EDNNENVGQDYAEESGGEGNEKSEDEFEEKFKNPYRLEGKFKDEADRAKIMAMTE 94

  Fly   180 KERETEIYKRIEQREIMRTRWEIERKLKLARRGEKNQEKSKNKGERAKKKKEKREKKARKAREAQ 244
            .|||:.:::|.|:                                 ..|..|:|| .|.:..:..
pombe    95 IERESILFEREEE---------------------------------ISKLMERRE-LAIRLHQQN 125

  Fly   245 APLPTQASTSTLLDVEPKPSNEVRSASPLSTPALNRDAASTSAAVASIMPDDAASSAGVSDYFDH 309
            |....|                       ||....||...||||            ||       
pombe   126 AQYMAQ-----------------------STRRSTRDKPLTSAA------------AG------- 148

  Fly   310 KERSKERKKNVEANKTDDKRSNAMALLKAKREGKAKREEEEAKRMAEKDRDDDKEELDSVSGCKS 374
                 :|.|..|..|                    :|:|..|:.::|:.|               
pombe   149 -----KRDKLTELKK--------------------RRQERSARSVSERTR--------------- 173

  Fly   375 AVKLKASEIYSDDSGSSDWDEEEKPAGKRSRSNSSKASSESEDEEKAPQRPVFITTRE------- 432
                |.|.:       ||::|:    .:..:|...:..|.|..|||..|     .:::       
pombe   174 ----KRSPV-------SDYEEQ----NESEKSEEEEGYSPSYAEEKVEQ-----VSKDNASANLY 218

  Fly   433 DLNKLRLSRYKMERFVNLPIFESTVLNCFVRISIGNNGQKPVYRVAEIVGVVETGKIYSLGTTRT 497
            |||.:||.|..:..::..|||||||..||||:.||....:.|||:.::.|::|:.|.|.:....|
pombe   219 DLNAIRLGRKHVAEYMYHPIFESTVTGCFVRVKIGERDGQGVYRLCQVKGILESRKPYRVDGVLT 283

  Fly   498 NRGLRLKHGTQERVFRLEFISNQEFTENEFNKWNEVCQQSHVQMPTIDLIAIKQNDIKKALNYEF 562
            ...|...||..:|||.:..:||:.|::::|.:|:....:..:.||:.:.:..|.||::....|..
pombe   284 KVSLECFHGRSKRVFDVNVLSNEPFSDHDFQRWHHQMMEDKLSMPSKNFVQRKLNDLRDMSKYVL 348

  Fly   563 KDEDVDKIVEEKNRFRNRPTNYAMKKTCLMKERDAAMLRGDYDIAQDLGQQIDELENRASELDKR 627
            .:::|..|:..|......|:|.|.:||.|.:.|.||.:.|:.::.:::..|::.||..:...::.
pombe   349 SEKEVSDIINRKKELSRVPSNIAAEKTRLRQRRQAAYVAGNAELVKEIDDQLNTLEELSMGSNQN 413

  Fly   628 RSHTLNLISYINDRNRKKN---VEDAEKAILEEARANKGLKISDPF------------------- 670
            .:..::.::.:|:|||::|   :..||:.:.||.|.......:.|.                   
pombe   414 SNSAMDQLAKVNERNRRRNHTEIRLAEQRMNEERRRLSAAATATPMSAPTSVLTGTSPQPSPSLS 478

  Fly   671 TRRITQPRMG------FKGAKKDEDDMQLAPLPPPPPGKKRPNEAGTSSASVRST-DSKDYSLY- 727
            |..::.|::.      ....|....|:.    |...|.:.:..:.|.:.....:| :.||:.|: 
pombe   479 TSIMSTPKLNPSESVVVASEKASSPDLS----PKLLPSESQIFDEGIAVTQTPNTLEDKDFKLHE 539

  Fly   728 -SLH---------DFDIDLDV 738
             ::|         ||.||:::
pombe   540 KAVHGIDDIIATVDFGIDINI 560

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rtf1NP_001286717.1 Plus3 428..535 CDD:197843 38/114 (33%)
SPBC651.09cNP_595507.1 COG5296 1..560 CDD:227615 148/670 (22%)
Plus3 214..321 CDD:197843 38/107 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002454
OrthoInspector 1 1.000 T1125903
orthoMCL 1 0.900 OOG5_129541
Panther 1 1.100 LDO PTHR13115
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1264
TreeFam 1 0.960
87.900

Return to query results.
Submit another query.