DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rtf1 and Cdk11b

Sequence 1:NP_001286717.1 Gene:Rtf1 FlyBaseID:FBgn0034722 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_665709.2 Gene:Cdk11b RGDID:628604 Length:784 Species:Rattus norvegicus

Alignment Length:663 Identity:131/664 (20%)
Similarity:239/664 (36%) Gaps:123/664 (19%)


  Fly    16 DSDSESETNLESDLMSLAKKRKKPQTAAKSSSR----SDSDSDWANNKAGAPSSKKKK---RQKP 73
            :.||.....|:..|..  |||:|.|.......|    .|.||...:.:.|.....:.:   |..|
  Rat     4 EKDSWKVKTLDEILQE--KKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSP 66

  Fly    74 SRDSSSSESNWDDDSQDERQPARQSPAQTQQEHKPPEQASQPAQLSEQEEGEVSDSDSDKSKSNS 138
            .|...|.|...::|.....:|                    |.|:|.:|:......:..|.|...
  Rat    67 YRREDSMEDRGEEDDSLAIKP--------------------PQQMSRKEKAHHRKDEKRKEKRRH 111

  Fly   139 SSSGSDSSSSSSSSDSEFDDGFDDDLMGDDEDRRRLNGLSEKERETEIYKRIEQREIMR--TRWE 201
            .|..::....:...:.|            .|..||.....|:::....::|.::||:.|  :|.|
  Rat   112 RSHSAEGGKHARVKEKE------------REHERRKRHREEQDKARREWERQKRREMAREHSRRE 164

  Fly   202 IERKLKLARRGEKNQE-KSKNKGERAKKKKEKREKKARKAREAQAPLPTQASTSTLLDVEPKPSN 265
            .:|..:|.|:.|:.:: :.:.|.:|.:|::|:|.::.||.|||:..:.....|.. .|...|...
  Rat   165 RDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMR-EDYSDKGKV 228

  Fly   266 EVRSASPLSTPALNRDAASTSAAVASIMPDDAASSAGVSDYFDHKERSKERKKNVEANKTDDKRS 330
            ...|.|||..|....:.......|.....::....:.:.|..|.:.::...:.:...:.:..:..
  Rat   229 GHWSRSPLRPPRERFELGDNRKPVREEKVEERDLLSDLQDISDSERKTSSAESSSAESGSGSEEE 293

  Fly   331 NAMALLKAKREGKAKREEEEAKRMAEKDRDDDKEELDSVSGCKSAVKLKASEIYSDDSGSSDWDE 395
            ......:.:.||....|.||     |::.::::||.::.|..:.|.:..|.|: ||:..|.|.|.
  Rat   294 EEEEEEEEEEEGSTSEESEE-----EEEEEEEEEEEETGSNSEEASEQSAEEV-SDEEMSEDEDR 352

  Fly   396 EEK------PAGKRSRSNSSKASSESEDEEKAPQRPV-----FITTREDLNKLRLSRYKMERFVN 449
            |.:      |..:..|.:......|.|..|..||...     ::.....|:.:.|   |.|....
  Rat   353 ENENHILVVPESRFDRDSGDSDEGEEEVGEGTPQSSAPTEGDYVPDSPALSPIEL---KQELPKY 414

  Fly   450 LPIFES----TVLNCFVRISIGNNGQKPVYRVAEIVGVVETGKIYSLGTTRTNRGLRLKHGTQER 510
            ||..:.    ....|..||..|..|  .|||..:               .:|:..:.||      
  Rat   415 LPALQGCRSVEEFQCLNRIEEGTYG--VVYRAKD---------------KKTDEIVALK------ 456

  Fly   511 VFRLEFISNQE-FTENEFNKWNEVCQQSHVQMPTIDLIAIKQNDIKKALNYEFKDEDVDKIVEE- 573
              ||:....:| |......:.|.:.:..|..:.|:..|.:..|..|..:...:.:.|:..::|. 
  Rat   457 --RLKMEKEKEGFPITSLREINTILKAQHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKSLMETM 519

  Fly   574 --------------------KNRFRNRPTNYAMKKTCLMKERDAAMLRGDYDIAQDLGQQID--- 615
                                |:...|...:..:|.:.|:......:..||:.:|::.|..:.   
  Rat   520 KQPFLPGEVKTLMIQLLSGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAREYGSPLKAYT 584

  Fly   616 ----ELENRASEL 624
                .|..||.||
  Rat   585 PVVVTLWYRAPEL 597

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rtf1NP_001286717.1 Plus3 428..535 CDD:197843 22/112 (20%)
Cdk11bNP_665709.2 STKc_CDC2L1 421..712 CDD:173741 36/203 (18%)
PLN00009 424..714 CDD:177649 36/200 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.