DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rtf1 and RTF1

Sequence 1:NP_001286717.1 Gene:Rtf1 FlyBaseID:FBgn0034722 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_055953.3 Gene:RTF1 HGNCID:28996 Length:710 Species:Homo sapiens

Alignment Length:808 Identity:314/809 (39%)
Similarity:452/809 (56%) Gaps:176/809 (22%)


  Fly     3 KRRTQSLIDSNSSDSDSESETNLESDLMSLAKKR------KKP---QTAAKSSSR-SDSDSDWA- 56
            ||:.:.:|||::.||.|:.  ||:.:|:||||::      |:|   |.||.|.|. ||||.:|. 
Human    44 KRKGRVVIDSDTEDSGSDE--NLDQELLSLAKRKRSDSEEKEPPVSQPAASSDSETSDSDDEWTF 106

  Fly    57 ----NNKAG-APSSKKKKRQKPSRDSSSSESNWDDDSQDERQPARQSPAQTQQEHKPPEQASQPA 116
                |.|.| |...:||...|...:.::|..:.|.||.                          |
Human   107 GSNKNKKKGKARKIEKKGTMKKQANKTASSGSSDKDSS--------------------------A 145

  Fly   117 QLSEQEEGEVSDSDSDKSKSNSSSSGSDSSSSSSSSDSEFDDGFDDDLMGDDEDRRRLNGLSEKE 181
            :.|..|||||||||     ||||||.||  |.|||.|.||.||:.:|||||:|||.||..::|||
Human   146 ESSAPEEGEVSDSD-----SNSSSSSSD--SDSSSEDEEFHDGYGEDLMGDEEDRARLEQMTEKE 203

  Fly   182 RETEIYKRIEQREIMRTRWEIERKLKLARRGEKNQEKSKNKGERAKKKKEKREKKARKAREAQAP 246
            ||.|::.|||:||:::.|:||::|||.|::.||.::|.       |:::|:.:||..:.:|:|. 
Human   204 REQELFNRIEKREVLKRRFEIKKKLKTAKKKEKKEKKK-------KQEEEQEKKKLTQIQESQV- 260

  Fly   247 LPTQASTSTLLDVEPKPSNEVRSASPLSTPALNRDAASTSAAVASIMPDDAASSAGVSDYFDHKE 311
                                                  ||                     .:||
Human   261 --------------------------------------TS---------------------HNKE 266

  Fly   312 RSKERKKNVEANKTDDKRSNAMALLKAKREGKAKREEEEAKRMAEKDRDDDKEELDSVSGCKSAV 376
            |..:|.:.:      ||:|.||..|||:||   ||:...|:.:|:|.                  
Human   267 RRSKRDEKL------DKKSQAMEELKAERE---KRKNRTAELLAKKQ------------------ 304

  Fly   377 KLKASEIYSDDSGSSDWDEEEKPAGKRSRSNSSKASSESEDEEKAPQRPVFITTREDLNKLRLSR 441
            .||.||:||||   .:.:|::|.:.|..||:.:.:|.|.|::|:.|.:...::..|:||::||||
Human   305 PLKTSEVYSDD---EEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELNRVRLSR 366

  Fly   442 YKMERFVNLPIFESTVLNCFVRISIGNNGQKPVYRVAEIVGVVETGKIYSLGTTRTNRGLRLKHG 506
            :|:||:.::|.|..||..|||||.|||:..|||||||||.|||||.|:|.||.||||:||:|:||
Human   367 HKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHG 431

  Fly   507 TQERVFRLEFISNQEFTENEFNKWNEVCQQSHVQMPTIDLIAIKQNDIKKALNYEFKDEDVDKIV 571
            ..:|||||||:|||||||:||.||.|....:.:|:||:|.|..|:..||:||||:|.|:|:::||
Human   432 NDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEALNYKFNDQDIEEIV 496

  Fly   572 EEKNRFRNRPTNYAMKKTCLMKERDAAMLRGDYDIAQDLGQQIDELENRASELDKRRSHTLNLIS 636
            :||.|||..|.|||||||.|:||:..|...||.|.|:.:..|::|||.||..||::|:..::.||
Human   497 KEKERFRKAPPNYAMKKTQLLKEKAMAEDLGDQDKAKQIQDQLNELEERAEALDRQRTKNISAIS 561

  Fly   637 YINDRNRKKNVEDAEKAILEEARANKGLKISDPFTRRITQPRMGFKGAKKDEDDMQLA------- 694
            |||.|||:.|:.::|||::.|:...|..:: ||||||..:|.:   .:...:..:|.|       
Human   562 YINQRNREWNIVESEKALVAESHNMKNQQM-DPFTRRQCKPTI---VSNSRDPAVQAAILAQLNA 622

  Fly   695 -----PLPPPP----PGKKRPNEAGTSSASVRSTDSKDYSLYSLHDFDIDLDVPLPVNTNSVPKP 750
                 .||..|    .|:.:..:..:.|||..|.|     |:.:||||:.:|:.:|.:.:.....
Human   623 KYGSGVLPDAPKEMSKGQGKDKDLNSKSASDLSED-----LFKVHDFDVKIDLQVPSSESKALAI 682

  Fly   751 ASK--PA-ETVSKRSLNLEDYKKKRGLI 775
            .||  || :...:||||||||||:||||
Human   683 TSKAPPAKDGAPRRSLNLEDYKKRRGLI 710

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rtf1NP_001286717.1 Plus3 428..535 CDD:197843 68/107 (64%)
RTF1NP_055953.3 Plus-3 359..459 CDD:308638 67/100 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5296
Hieranoid 1 1.000
Homologene 1 1.000 H133868
Inparanoid 1 1.050 420 1.000 Inparanoid score I1778
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002454
OrthoInspector 1 1.000 T1075379
orthoMCL 1 0.900 OOG5_129541
Panther 1 1.100 LDO PTHR13115
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1264
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.