DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rtf1 and rtfo-1

Sequence 1:NP_001286717.1 Gene:Rtf1 FlyBaseID:FBgn0034722 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_505473.1 Gene:rtfo-1 WormBaseID:WBGene00009103 Length:613 Species:Caenorhabditis elegans

Alignment Length:798 Identity:220/799 (28%)
Similarity:357/799 (45%) Gaps:241/799 (30%)


  Fly    12 SNSSDSDSESETNLESDLMSLAKKRKKPQTAAKSSSRSDSDSDWANNKAGAPSSKKKKRQKPSRD 76
            |:|..:.|:.||           ||:.|.|     |.|||||| |..|.|.|.         |.|
 Worm     2 SSSESASSDEET-----------KRRAPAT-----SDSDSDSD-AGPKPGKPL---------STD 40

  Fly    77 SSSSESNWDDDSQDERQPARQSPAQTQQEHKPPEQASQPAQLSEQEEGEVSDSDSDKSKSNSSSS 141
            ||:|:|   |..:.:.:||::. ..|:::.:                                  
 Worm    41 SSASDS---DAEKPQAKPAKKK-TLTKRKRR---------------------------------- 67

  Fly   142 GSDSSSSSSSSDSEFDDGFDDDLMGDDEDRRRLNGLSEKERETEIYKRIEQREIMRTRWEIERKL 206
                  ::.|||   ||..||||..|.||:.|...|:|.|:|.||::|:|.||....|.||.:  
 Worm    68 ------ATGSSD---DDQVDDDLFADKEDKARWKKLTELEKEQEIFERMEARENAIAREEIAQ-- 121

  Fly   207 KLARRGEKNQEKSKNKGERAKKKKEKREKKARKAREAQAPLPTQASTSTLLDVEPKPSNEVRSAS 271
            :||::.:|:.||.        .|.|||.|......:|.:|                         
 Worm   122 QLAKKAKKSSEKG--------VKTEKRRKMNSGGSDAGSP------------------------- 153

  Fly   272 PLSTPALNRDAASTSAAVASIMPDDAASSAGVSDYFDHKERSKERKKNVEANKTDDKRSNAMALL 336
                   .|.|:|.|         |:...|..     |:.....||         .|..|||..|
 Worm   154 -------KRKASSDS---------DSEMDAAF-----HRPSDINRK---------HKEKNAMDAL 188

  Fly   337 KAKREGKAKREEEEAKRMAEKDRDDDKEELDSVSGCKSAVKLKASEIYSDDSGSSDWDEEEKPAG 401
            |.||           |.:.:|:..::...:|:|.|.              :||||.         
 Worm   189 KNKR-----------KEIEKKNAKNEALSIDAVFGA--------------NSGSSS--------- 219

  Fly   402 KRSRSNSSKASSESEDEEKAPQRPVFITTRE-----------DLNKLRLSRYKMERFVNLPIFES 455
              |.|:|..:.|.|...|.:|:|   ::.::           :|.:.||||:|:...::.|.|:|
 Worm   220 --SSSSSESSRSSSSSRESSPER---VSEKDKIVKKDVDGLSELRRARLSRHKLSLMIHAPFFDS 279

  Fly   456 TVLNCFVRISIGN-NGQKPVYRVAEIVGVVETGKIYSLGTTRTNRGLRLKHGTQERVFRLEFISN 519
            ||:.|:||:..|. :|....||:.:||||.|:.|:|.|...:||:.::.::|..||.||::|:||
 Worm   280 TVVGCYVRLGQGQMSGSGSKYRIWKIVGVEESNKVYELEGKKTNKIIKCQNGGSERPFRMQFVSN 344

  Fly   520 QEFTENEFNKWNEVCQQSHVQMPTIDLIAIKQNDIKKALNYEFKDEDVDKIVEEKNRFRNRPTNY 584
            .:|.:.||::|...|:: |..:||:|::..|:.||:||:|:::.|::||.:::||::::..|.|:
 Worm   345 ADFEQIEFDEWLLACKR-HGNLPTVDIMDKKKQDIEKAINHKYSDKEVDLMIKEKSKYQTVPRNF 408

  Fly   585 AMKKTCLMKERDAAMLRGDYDIAQDLGQQIDELENRASELDKRRSHTLNLISYINDRNRKKNVED 649
            ||.|....|:::.|..|||...|:.:..:|||:|.:|.||:|.||.:::.|::||.|||.|    
 Worm   409 AMTKANWSKQKELAQQRGDIREAEQIQTKIDEIERQADELEKERSKSISAIAFINHRNRSK---- 469

  Fly   650 AEKAILEEARANKGLKI-----SDPFTRRITQPRMGFKGAK--------------------KDED 689
                 :::...:..|||     .|||||:....|: ..|:|                    ||:.
 Worm   470 -----IKDQVLSGQLKIEENSQDDPFTRKKGGMRV-VSGSKSRLDGTLSASSSTTNLSDGGKDKS 528

  Fly   690 DMQLAPLPPPPPGKKRPNEAGTSSASVRSTDSKDYSLYSLHDFDIDLDVPLPVNTNSVPKPASKP 754
            .....|..|||           |:...:.||     :.||||||:|:|:....:.::.....:|.
 Worm   529 SSLAKPTQPPP-----------STQIKKKTD-----ISSLHDFDLDIDLGKLKDFSTPESSGNKR 577

  Fly   755 AETVSKRSLNLEDYKKKR 772
            ....|.:.::|.||:.:|
 Worm   578 PSISSSKGVSLSDYRMRR 595

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rtf1NP_001286717.1 Plus3 428..535 CDD:197843 41/119 (34%)
rtfo-1NP_505473.1 COG5296 82..503 CDD:227615 157/536 (29%)
Plus3 252..360 CDD:197843 41/108 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130861062
eggNOG 1 0.900 E1_COG5296
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 246 1.000 Inparanoid score I2020
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002454
OrthoInspector 1 1.000 T475010
orthoMCL 1 0.900 OOG5_129541
Panther 1 1.100 LDO PTHR13115
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1264
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.