DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oatp58Db and slco5a1a

DIOPT Version :8

Sequence 1:NP_611658.3 Gene:Oatp58Db / 37544 FlyBaseID:FBgn0034715 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_001340277.1 Gene:slco5a1a / 570033 ZFINID:ZDB-GENE-090316-1 Length:549 Species:Danio rerio

Alignment Length:454 Identity:134/455 (29%)
Similarity:223/455 (49%) Gaps:55/455 (12%)


  Fly   239 LGPAMGFSMVSLCLRLYIDPFKKPLITTNDPRWMGAWWIGWIL--LTFILTISAVFVGMFPKEMP 301
            ||||.|:.:..:.:..|:||.....|...|||::|.||.|::|  :..:|.|..:|  .|||::|
Zfish    18 LGPAAGYLLGGILIGFYVDPGTVVNIDQGDPRFVGNWWSGFLLCAVAMLLVIFPMF--SFPKKLP 80

  Fly   302 --RAKARRLKADGEEDIPL-----------------AGRSFQDMLDSLKRLASNKVYVYNMLASI 347
              :.|::|....|..|:..                 .|::.:|:..:..|:.||..:::..|:..
Zfish    81 PRQKKSKRGVKKGAGDVSSDDEMMKEKSQAVSSSMGFGKNIKDLPKAAVRILSNVTFLFVSLSYT 145

  Fly   348 LYLFGYMPYWIFTPKYIEIQYRQSASTSTMATGTWALGFSAAGILISGYVISKYKPSARAMAAWN 412
            ........:..|.||:||.|:...||::::.||...:..:..||.:.||:|.|.|..||..|...
Zfish   146 AECAIVTAFITFIPKFIESQFGVPASSASIYTGLIIVPSAGVGIFLGGYIIKKLKLGAREAAKLA 210

  Fly   413 FVVDYLTVAGMLCY---VLVGCDESDRANSLSI-VPTG-----------DSCSASCVCEYVYYAP 462
            .:...::   :||:   .:||| ||.....::| ..||           .||:.:|.|:...|||
Zfish   211 MICSGVS---LLCFSTLFIVGC-ESINLGGINIPYTTGPTLTLSHRNLTGSCNVNCGCKIHEYAP 271

  Fly   463 VCSPENITFISACHAGCTDKAINELGKTIYTGCRCMGNVSSI--------ISLSNVTSLASQSQI 519
            ||..:.||:.:.|.|||::.|.:..|...|:.|.|:.:...|        :.|..|.:..:::..
Zfish   272 VCGSDGITYFNPCLAGCSNIANHTSGIRNYSDCACVQSRQVITPSGGNHELQLVIVKTYLNENGF 336

  Fly   520 AMDGACPVDCNK--QFLIFLAVMCFLKFVGATGRSSNLLLALRCVPSKDKTFSLGFGSMVYSVLA 582
            |:.|.|...|..  .|||||.:   :..:.|..:.|.:::.||.|..:|:.|:||...::...||
Zfish   337 ALAGKCERTCGTLITFLIFLFI---VTLITACAQPSVIIVTLRSVDEEDRPFALGMQFVLLRTLA 398

  Fly   583 FIPSPIVFGWMLDSYCLVWGKTCSSKGNCWIYDTKSLRYTMNLVCASLIFLGSFWNIGVWYHAK 646
            :||:||.||.::|:.|::|.:.|...|:||.||..|||:....:.|||.|||..:....||..|
Zfish   399 YIPTPIYFGAVIDTTCMLWQQDCGFHGSCWEYDVTSLRFVYFGLAASLKFLGFLFIFLTWYSLK 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oatp58DbNP_611658.3 OATP 53..619 CDD:281175 123/426 (29%)
MFS 55..>410 CDD:119392 54/192 (28%)
KAZAL_SLC21 447..499 CDD:238650 20/52 (38%)
slco5a1aNP_001340277.1 OATP <9..435 CDD:308646 123/426 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3626
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.