DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oatp58Db and Gm5724

DIOPT Version :8

Sequence 1:NP_611658.3 Gene:Oatp58Db / 37544 FlyBaseID:FBgn0034715 Length:680 Species:Drosophila melanogaster
Sequence 2:XP_978409.2 Gene:Gm5724 / 435927 MGIID:3643685 Length:670 Species:Mus musculus

Alignment Length:703 Identity:169/704 (24%)
Similarity:293/704 (42%) Gaps:106/704 (15%)


  Fly    23 DDEKRLNSSDTTCGFSIFRGPALQRFATAHMFVIVYGIASCFLAMAFTYFTGTITTMEKRFNIPT 87
            :.|.|:.:....|            |:...:|::....|....::..::....:..:|::|.:.|
Mouse     3 ETETRILTRGVRC------------FSKVKVFLLALTGACVSKSLTGSHMKSMLLQIERQFGLLT 55

  Fly    88 KISGLITVGNDISTVFSSAFLSYYASRGHRPRWVALGLIIIAIFCLLMLTPHIFYGPGEEALRLT 152
            ...||||....:..:.....:||:.::.|||..:.:|.:.:.:.|.::..||...|         
Mouse    56 STVGLITGSFSMGMLLVIIPVSYFGTKLHRPIMIGVGCMFMGLGCFIISLPHFLMG--------- 111

  Fly   153 EEYGMSESFGASLNITEKNDSLCHEKNSNCLERAGDYTPI---------VLFFIAQFIGGIGCSL 208
             .|....:...:.|:: .|..||.|..|..|:...|.|..         :...:...|.|:|.:.
Mouse   112 -RYEYETTISPTSNLS-SNSFLCMENRSLTLKPTQDTTECGREIKSLMWIYVLVGNIIRGMGETA 174

  Fly   209 FYAPGLSYMDDNSASSKTPAMLSWSSFLRMLGPAMGFSMVSLCLRLYIDP----FKKPLITTNDP 269
            ....|:||::|.:.|..:|..:........:...:|:|:.|.|..:|:|.    .....||..|.
Mouse   175 IMPLGISYIEDFAKSENSPLYIGILEIGITISYWIGYSLGSFCANIYVDTDSGNTDDLTITPTDT 239

  Fly   270 RWMGAWWIGWILLTFILTISAVFVGMFPKEMP--------------RAKARRLKADGEEDIPLAG 320
            ||:||||||:::...:..::::....|||.:|              :.:..|.||..|..     
Mouse   240 RWVGAWWIGFLVCAGVNFLTSIPFFFFPKTLPKEGLQDNGDGTENAKEEKHREKAKKENQ----- 299

  Fly   321 RSFQDMLDSLKRLASNKVYVYNMLASILYLFGYMPYWIFTPKYIEIQYRQSASTSTMATGTWALG 385
            |..:|....:|.|:.|.:|:..:|.|:|....::....:.|||:|.||.:|::......|.:.|.
Mouse   300 RIIKDFFPLMKNLSCNPIYMLYLLISVLQFNTFVSMVSYVPKYLEQQYGKSSADVLFIMGIYMLP 364

  Fly   386 FSAAGILISGYVISKYKPSARAMAAWNF---VVDYLTVAGMLCYVLVGCDESDRANSLSIVPTG- 446
            ....|.|:.|.::.|:|.:|:..|...|   :.|||.   .|...:..|| |.:...|:....| 
Mouse   365 PICLGYLLGGLIMKKFKITAKKAAYIAFCLSLTDYLL---SLSNYMTNCD-SFQVAGLTASYEGV 425

  Fly   447 -----------DSCSASCVCEYVYYAPVCSPENITFISACHAGCTDKAINELGKTIYTGCRCM-- 498
                       ..|:..|.|....:.|||....:.::|||.||| :|::......::..|.|:  
Mouse   426 QHPLHVDHEVLADCNTRCSCLTNTWDPVCGNNGLAYMSACLAGC-EKSVGNGINMVFQNCSCIRS 489

  Fly   499 -GNVSSIISLSNVTSLASQSQIAMDGACPVDCNKQFLIFLAVMCFLKFVGATGRSSNLLLALRCV 562
             ||.|:::.|.|...               ||:.....|:.:.....|:.:.......::.|||:
Mouse   490 SGNSSAVLGLCNKGP---------------DCDNMLKYFIIIFSVKMFIFSLSSIPGYMVLLRCM 539

  Fly   563 PSKDKTFSLGFGSMVYSVLAFIPSPIVFGWMLDSYCLVWGK-TCSSKGNCWIYDTKSLRYTMNLV 626
            ..::|:..:|..:....:.|.||:||.||.::|..||.||. .|..|..|.|||..|.||....:
Mouse   540 KPEEKSLGVGLHTFCTKIFAGIPAPIYFGALIDRACLHWGTLKCGEKAACRIYDINSFRYLFFGL 604

  Fly   627 CASLIFLGSFWNIGVWYHAKDMKVFDEDEKTVQAKQSDDIELK-----EKPND 674
            .|:|  .||.:...| :..:.|:.|...|.|    .|.|.||.     ||.||
Mouse   605 PAAL--TGSSYLPAV-FLLRLMRTFQLPEDT----DSPDTELAETKLIEKEND 650

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oatp58DbNP_611658.3 OATP 53..619 CDD:281175 146/612 (24%)
MFS 55..>410 CDD:119392 87/382 (23%)
KAZAL_SLC21 447..499 CDD:238650 15/55 (27%)
Gm5724XP_978409.2 oat 1..624 CDD:273279 158/672 (24%)
MFS 42..>397 CDD:119392 87/371 (23%)
KAZAL_SLC21 436..487 CDD:238650 15/52 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3626
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1029129at2759
OrthoFinder 1 1.000 FOG0000112
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.