DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oatp58Db and Slco1a4

DIOPT Version :8

Sequence 1:NP_611658.3 Gene:Oatp58Db / 37544 FlyBaseID:FBgn0034715 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_001342506.1 Gene:Slco1a4 / 28250 MGIID:1351896 Length:670 Species:Mus musculus

Alignment Length:725 Identity:182/726 (25%)
Similarity:305/726 (42%) Gaps:129/726 (18%)


  Fly    25 EKRLNSSDTTCGFSIFRGPALQRFATAHMFVIVYGIASCFLAMAFTYFTGTITTMEKRFNIPTKI 89
            ||.:.:....|            |:....|::....|....:::.||....:|.:|::|.|||.:
Mouse     5 EKEVATHGVRC------------FSKIKAFLLALTCAYVSKSLSGTYMNSMLTQIERQFGIPTSV 57

  Fly    90 SGLITVGNDISTVFSSAFLSYYASRGHRPRWVALGLIIIAIFCLLMLTPHIFYGPGEEALRLTEE 154
            .|||....:|..:....|:||:.::.|||..:.:|..::.:.|.|:..||...|..|....:...
Mouse    58 VGLINGSFEIGNLLLIIFVSYFGTKLHRPIMIGVGCAVMGLGCFLISIPHFLMGRYEYETTILPT 122

  Fly   155 YGMSESFGASLNITEKNDSLCHEKNSNCLERAGDYTPIV-----LFFIAQFIG----GIGCSLFY 210
            ..:|           .|..:|.|..:..|:...|.|..|     |.:|...:|    |:|.:...
Mouse   123 SNLS-----------SNSFVCTENRTQTLKPTQDPTECVKEMKSLMWIYVLVGNIIRGMGETPIM 176

  Fly   211 APGLSYMDDNSASSKTPAMLSWSSFLRMLGPAMGFSMVSLCLRLYIDP----FKKPLITTNDPRW 271
            ..|:||::|.:.|..:|..:........:||.:|..:.|.|..:|:|.    .....||..|.||
Mouse   177 PLGISYIEDFAKSENSPLYIGILETGMTIGPLIGLLLGSSCANIYVDTGSVNTDDLTITPTDTRW 241

  Fly   272 MGAWWIGWILLTFILTISAVFVGMFPKEMPRAKARRLKADGEED---------IPLAGRSF-QDM 326
            :||||||:::...:..::::....|||.:.: :..:...||.|:         |....|.. :|.
Mouse   242 VGAWWIGFLVCAGVNILTSIPFFFFPKTLLK-EGLQDNGDGTENAKEEKHREKIKEENRGITKDF 305

  Fly   327 LDSLKRLASNKVYVYNMLASILYLFGYMPYWIFTPKYIEIQYRQSASTSTMATGTWALGFSAAGI 391
            ...:|.|:.|.:|:..:|.|::.:..::..:.|.|||:|.||.:|.:......|.:.|.....|.
Mouse   306 FLFMKSLSCNPIYMIFILISVIQVNAFINSFTFMPKYLEQQYGKSTAEIVFLMGLYMLPPICLGY 370

  Fly   392 LISGYVISKYKPSARAMA---AWNFVVDYLTVAGMLCYVLVGCDESDRA---------------- 437
            ||.|.::.|:|.:.:..|   .|..:.:||  ...:.|::. ||....|                
Mouse   371 LIGGLIMKKFKITVKKAAYIGFWLSLTEYL--LSFVSYIMT-CDNFPVAGLTTSYEGVQHPLYVE 432

  Fly   438 -NSLSIVPTGDSCSASCVCEYVYYAPVCSPENITFISACHAGCTDKAINELGKTIYTGCRCM--- 498
             |.|:      .|:..|.|....:.|||....::::|||.||| :|::......::..|.|:   
Mouse   433 NNVLA------DCNTKCSCLTNTWDPVCGDNGLSYMSACLAGC-EKSVGTGTNMVFQNCSCIQSS 490

  Fly   499 GNVSSIISLSNVTSLASQSQIAMDGAC---PVDCNK--QFLIFLAVMCFLKFVGATGRSSNLLLA 558
            ||.|:::                 |.|   |...||  .|||...:.||:..:||.   ...::.
Mouse   491 GNASAVL-----------------GLCDKGPECANKLQYFLIISIIGCFIFSLGAI---PGYMVL 535

  Fly   559 LRCVPSKDKTFSLGFGSMVYSVLAFIPSPIVFGWMLDSYCLVWGK-TCSSKGNCWIYDTKSL-RY 621
            |||:.|::|:..:|..:....:|..||:||.||.::|..||.||. .|...|.|.:||..|. |.
Mouse   536 LRCMKSEEKSLGVGLHTFCMRILGGIPAPIYFGALIDRTCLHWGTLKCGEPGACRMYDINSFRRI 600

  Fly   622 TMNLVCA-----------SLIFLGSFWNIGVWYHAKDMKVFDED--EKTVQAKQSDDIELKEKP- 672
            .:.|..|           .||.:..|...|      |:...|.|  |..:.||:|....:...| 
Mouse   601 YLGLPAALRGASFLPALFILILMRKFQFPG------DIDSSDTDPAEMKLTAKESKCTNVHRSPT 659

  Fly   673 --NDVVTKKK 680
              ||...|.|
Mouse   660 MQNDGERKTK 669

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oatp58DbNP_611658.3 OATP 53..619 CDD:281175 159/618 (26%)
MFS 55..>410 CDD:119392 95/381 (25%)
KAZAL_SLC21 447..499 CDD:238650 15/55 (27%)
Slco1a4NP_001342506.1 oat 1..625 CDD:273279 168/674 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3626
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1029129at2759
OrthoFinder 1 1.000 FOG0000112
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.684 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.