DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oatp58Db and Slco2b1

DIOPT Version :8

Sequence 1:NP_611658.3 Gene:Oatp58Db / 37544 FlyBaseID:FBgn0034715 Length:680 Species:Drosophila melanogaster
Sequence 2:XP_006229783.1 Gene:Slco2b1 / 140860 RGDID:621391 Length:693 Species:Rattus norvegicus

Alignment Length:656 Identity:179/657 (27%)
Similarity:292/657 (44%) Gaps:106/657 (16%)


  Fly    48 FATAHMFVIVYGIASCFLAMAFTYFTGTITTMEKRFNIPTKISGLITVGNDISTVFSSAFLSYYA 112
            |.....||:.:.|......|...|...:|:|:||||.:.::.|||:...|::..:....|:||:.
  Rat    47 FQNIKFFVLCHSILQLAQLMISGYLKSSISTVEKRFGLSSQTSGLLAAFNEVGNISLILFVSYFG 111

  Fly   113 SRGHRPRWVALGLIIIAIFCLLMLTPHIFYGPGEEALRLTEEYGMSESFGASLNITEKNDSLCHE 177
            ||.||||.:..|.|::|:..|||..||....|........|:  .|:.|.|||.:..........
  Rat   112 SRVHRPRMIGCGAILVAVAGLLMALPHFISEPYRYDHSSPED--RSQDFEASLCLPTTMAPASAL 174

  Fly   178 KNSNCLER--AGDYTPIVLFFIAQFIGGIGCSLFYAPGLSYMDDNSASSKTPAMLSWSSFLRMLG 240
            .|.:|..|  ....|.:.:.|.||.:.|||.......|:||:||.:..|.:|..|.....:.|:|
  Rat   175 SNDSCSSRTETKHLTMVGIMFTAQTLLGIGGVPIQPFGISYIDDFAHHSNSPLYLGILFAITMMG 239

  Fly   241 PAMGFSMVSLCLRLYIDPFKKP----LITTNDPRWMGAWWIGWILLTFILTISAVFVGMFPKEMP 301
            |.:.:.:.||.||||:|..:.|    .:||.||||:||||:|:::...::.::|.....||:|||
  Rat   240 PGLAYGLGSLMLRLYVDIDRMPEGGINLTTKDPRWVGAWWLGFLISAGLVVLAASPYFFFPREMP 304

  Fly   302 RAK----ARRLKADGEEDIPLAGRSFQDMLDSLKRLAS-------------NKVYVYNMLASILY 349
            :.|    .|:....|...|...|.......:.||:.|.             .||:...:|.::.:
  Rat   305 KEKYELHFRQKVLAGGASIGSKGEELSSQHEPLKKQAGLPQIAPDLTVVQFIKVFPRVLLRTLRH 369

  Fly   350 LFGYMPYWI------------------FTPKYIEIQYRQSASTSTMATGTWALGFSAAGILISGY 396
                 |.::                  |.||::|.|:..:||.:.:..|...:..:..||::.|.
  Rat   370 -----PIFLLVVLSQVCTSSMVAGTATFLPKFLERQFSITASFANLLLGCLTIPLAIVGIVVGGV 429

  Fly   397 VISKYKPSARAMAAWNFVVDYLTVAG-MLCYVL------VGCDESDRA---NSLSIVPTGDS--- 448
            ::.:...|....:|       |.:.| :||.:|      :||.....|   ..|...| |.|   
  Rat   430 LVKRLHLSPMQCSA-------LCLLGSLLCLLLSLPLFFIGCSTHHIAGITQDLGAQP-GPSLFP 486

  Fly   449 -CSASCVCEYVYYAPVC-SPENITFISACHAGCTDKAINEL---GKTIYTGCRCM---GNVSSII 505
             ||..|.|:...:.||| :...:.:.:.||||||.:.:.|.   .:..||.|.|:   |.:|:  
  Rat   487 GCSEPCSCQSDDFNPVCDTSAYVEYTTPCHAGCTGRVVQEALDKSQVFYTNCSCVAGNGTISA-- 549

  Fly   506 SLSNVTSLASQSQIAMDGACPVDCNKQFLIFLAVMCFLKFVGATGRSSNLLLALRCVPSKDKTFS 570
                             |:|...|::..|.|:.::.....|.:...:.:.:|.||.|..:|||.:
  Rat   550 -----------------GSCESACSRLVLPFILLISLGAAVASITHTPSFMLILRGVKKEDKTLA 597

  Fly   571 LGFGSMVYSVLAFIPSPIVFGWMLDSYCLVWGKTCSSKGNCWIYDTKSLRYTM----------NL 625
            :|...|:..|||::|||::.|..:|:.|:.|..||..:..|..||...||...          :|
  Rat   598 VGMQFMLLRVLAWMPSPVIHGSAIDTTCVHWALTCGRRAVCRYYDHDLLRNRFIGLQFFFKSGSL 662

  Fly   626 VCASLI 631
            ||.:|:
  Rat   663 VCFALV 668

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oatp58DbNP_611658.3 OATP 53..619 CDD:281175 172/628 (27%)
MFS 55..>410 CDD:119392 108/396 (27%)
KAZAL_SLC21 447..499 CDD:238650 19/63 (30%)
Slco2b1XP_006229783.1 OATP 52..646 CDD:281175 172/628 (27%)
MFS 58..>301 CDD:119392 80/245 (33%)
KAZAL_SLC21 484..541 CDD:238650 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3626
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1029129at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.684 Consistency score
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.