DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oatp58Db and Slco1a5

DIOPT Version :8

Sequence 1:NP_611658.3 Gene:Oatp58Db / 37544 FlyBaseID:FBgn0034715 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_001254636.1 Gene:Slco1a5 / 108096 MGIID:1351865 Length:670 Species:Mus musculus

Alignment Length:717 Identity:176/718 (25%)
Similarity:310/718 (43%) Gaps:105/718 (15%)


  Fly    21 VADDEKRLNSSDTTCGFSIFRGPALQRFATAHMFVIVYGIASCFLAMAFTYFTGTITTMEKRFNI 85
            :.:.|||:.:....|            |:...||::....|....:::..|....:|.:|::|:|
Mouse     1 MGETEKRIATHGVRC------------FSKIKMFLLALTCAYVSKSLSGIYMNSMLTQIERQFDI 53

  Fly    86 PTKISGLITVGNDISTVFSSAFLSYYASRGHRPRWVALGLIIIAIFCLLMLTPHIFYGPGEEALR 150
            ||.|.|||....:|..:.....:||:.::.|||..:.:|.:|:.:.|.||..||...|       
Mouse    54 PTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGLGCFLMSLPHFLMG------- 111

  Fly   151 LTEEYGMSESFGASLNITEKNDSLCHEKNSNCLERAGDYTPIV-----LFFIAQFIG----GIGC 206
               .|....:...:.|:: .|..||.|..:..|:...|....|     |.:|...:|    |||.
Mouse   112 ---RYEYETTISPTSNLS-SNSFLCMENRTQTLKPTQDPAECVKEMKSLMWIYVLVGNIIRGIGE 172

  Fly   207 SLFYAPGLSYMDDNSASSKTPAMLSWSSFLRMLGPAMGFSMVSLCLRLYIDP----FKKPLITTN 267
            :.....|:||::|.:.|..:|..:......:|:||.:|..:.|.|.|:|:|.    .....||..
Mouse   173 TPIMPLGISYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYVDTGSVNTDDLTITPT 237

  Fly   268 DPRWMGAWWIGWILLTFILTISAVFVGMFPKEMPRA----KARRLKADGEEDIPLAGRS-----F 323
            |.||:||||||:::...:..::::....|||.:|:.    ...|.:.|.||......:.     .
Mouse   238 DTRWVGAWWIGFLVCAGVNILTSIPFFFFPKTLPKEGLQDNVDRTENDKEEKHREKAKEENRGIT 302

  Fly   324 QDMLDSLKRLASNKVYVYNMLASILYLFGYMPYWIFTPKYIEIQYRQSASTSTMATGTWALGFSA 388
            :|.|..:|.|:.|.:|:..:|.|:|.:..::..:.|.|||:|.||.:|.|...:..|...|....
Mouse   303 KDFLPFMKSLSCNPIYMLLILTSVLQINAFINMFTFLPKYLEQQYGKSTSEVVLLIGVCNLPPIC 367

  Fly   389 AGILISGYVISKYKPSARAMAAWNFVVDYLTVAGMLCYVLVGCDESDRANSLSIVPTG------- 446
            .|.|:.|:::.|::.:.:..|...|.:..........:.::.||....| .|:....|       
Mouse   368 IGYLLIGFIMKKFRITVKKAAYMAFCLSLFEYLLSYFHFMISCDNFQVA-GLTTSYEGVQHPLYV 431

  Fly   447 -----DSCSASCVCEYVYYAPVCSPENITFISACHAGCTDKAINELGKTIYTGCRCM---GNVSS 503
                 ..|:..|.|....:.|||....::::|||.||| :|::......::..|.|:   ||.|:
Mouse   432 ENKVLADCNTRCSCLTNTWDPVCGDNGLSYMSACLAGC-EKSVGMGTHMVFQNCSCIQSSGNSSA 495

  Fly   504 IISLSNVTSLASQSQIAMDGACP--VDCNKQFLIFLAVMCFLKFVGATGRSSNLLLALRCVPSKD 566
            ::                 |.|.  .:|..:...||.:.....|:.:.......::.|||:.|::
Mouse   496 VL-----------------GLCKKGPECANKLQYFLIMSVIGSFIYSITAIPGYMVLLRCIKSEE 543

  Fly   567 KTFSLGFGSMVYSVLAFIPSPIVFGWMLDSYCLVWGK-TCSSKGNCWIYDTKSLRYTMNLVCAS- 629
            |:..:|..:....:.|.||:||.||.::|..||.||. .|...|.|.:|:..:.|....::.|: 
Mouse   544 KSLGIGLHAFCTRIFAGIPAPIYFGALIDRTCLHWGTLKCGEPGACRMYNINNFRRIYLVLPAAL 608

  Fly   630 -----------LIFLGSFWNIGVWYHAK----DMKVFDEDEKTVQAKQSDDI-ELKEKPNDVVTK 678
                       ||.:..|...|..|.::    |||:      ||:..:..|: .:.:..||...|
Mouse   609 RGSSYLPAFFILILMRKFQLPGEMYSSETELADMKL------TVKKSECTDVHRIPKVENDGELK 667

  Fly   679 KK 680
            .|
Mouse   668 TK 669

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Oatp58DbNP_611658.3 OATP 53..619 CDD:281175 154/606 (25%)
MFS 55..>410 CDD:119392 100/377 (27%)
KAZAL_SLC21 447..499 CDD:238650 15/55 (27%)
Slco1a5NP_001254636.1 oat 1..625 CDD:273279 163/666 (24%)
MFS 23..>397 CDD:119392 101/385 (26%)
KAZAL_SLC21 436..488 CDD:238650 15/53 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3626
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1029129at2759
OrthoFinder 1 1.000 FOG0000112
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.684 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.