DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and HEL1

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_012942.3 Gene:HEL1 SGDID:S000001725 Length:551 Species:Saccharomyces cerevisiae

Alignment Length:540 Identity:156/541 (29%)
Similarity:258/541 (48%) Gaps:93/541 (17%)


  Fly     4 DIEMDMESDNDGE---YDDDYDYYNTGEDCDVERLDPKRADPEYFEYECLTVEDIEKLLNERVEK 65
            |.|.|:..|.||.   |:...|...|..:   :|:..:.:.|. ..|||||.:.|.:.:.:||:.
Yeast    49 DSEFDINEDEDGVDTIYEGMLDAPLTKNN---KRILCEGSVPN-LSYECLTTKGIFERMLQRVDH 109

  Fly    66 LNTILQITPSLAKVLLLEH-QWNNVAVVEKYRQDANALLVTARIKPPSVAVTDTASTSAAAASAQ 129
            |..|..| ||...::||:| .||...::|.:.:..:.|||                         
Yeast   110 LQPIFAI-PSADILILLQHYDWNEERLLEVWTEKMDELLV------------------------- 148

  Fly   130 LLRLGSSGYKTTASATP--QYRSQM----------CPVCASSQLGDKFYSLACGHSFCKDCWTIY 182
                 ..|..|||:...  .|.|..          |.:|...:..:.| :|.|||.:|.:|:..|
Yeast   149 -----ELGLSTTANIKKDNDYNSHFREVEFKNDFTCIICCDKKDTETF-ALECGHEYCINCYRHY 207

  Fly   183 FETQIFQGISTQIGCMAQMCNVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSH-PELRFCPGPN 246
            .:.::.:|  ..|.||.  |::.:..:.:..::..| ...|....:.|.:|:.| ...::||..:
Yeast   208 IKDKLHEG--NIITCMD--CSLALKNEDIDKVMGHP-SSSKLMDSSIKSFVQKHNRNYKWCPFAD 267

  Fly   247 CQIIVQSSEISAKRAI----------CKACHTGFCFRCGMDYHAPTDCQVIKKWLTKCADDSETA 301
            |:.||...:.|:....          |.:.|. |||.||.:.|:|.||::...|:.|...:||..
Yeast   268 CKSIVHLRDTSSLPEYTRLHYSPFVKCNSFHR-FCFNCGFEVHSPADCKITTAWVKKARKESEIL 331

  Fly   302 NYISAHTKDCPKCHICIEKNGGCNHMQCFNCKHDFCWMCLGDWKTHGSEYYECSRYKDNPNIANE 366
            |::.:|||:||||.:.||||||||||.|.:||::|||:|.|.|..||..:::|:.||:|.:  |:
Yeast   332 NWVLSHTKECPKCSVNIEKNGGCNHMVCSSCKYEFCWICEGPWAPHGKNFFQCTMYKNNED--NK 394

  Fly   367 SVHVQ-AREALKKYLHYYERWENHSKSLKLE---QQT----IDRLRQRINSKVMNGSGTWIDWQY 423
            |.:.| |.:.||||..||..:..|..|.||:   .||    :..|::||..       :|||.|:
Yeast   395 SKNPQDANKTLKKYTFYYRLFNEHEVSAKLDWNLGQTLGTKVHALQERIGI-------SWIDGQF 452

  Fly   424 LFNAAALLAKCRYTLQYTYPYAYYMEAG-SRKNLFEYQQAQLEAEIENLSWKIERAETTDL---- 483
            |..:..:|.:.|..|::::..|||.:|. :...:|...|..|...:|:|| ::.:.:|.::    
Yeast   453 LSESLKVLNEGRTVLKWSFAVAYYSDASHNLTKIFVDNQMLLANAVESLS-ELLQIKTPEVIMKR 516

  Fly   484 -GDLENQMDIAEKRRTTLLK 502
             .:..|:....|.|.|.|::
Yeast   517 RPEFYNKAGYVENRTTALME 536

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763 20/73 (27%)
HEL1NP_012942.3 RING-HC_RBR_HEL2_like 177..222 CDD:319539 14/48 (29%)
RING-HC finger (C3HC4-type) 179..220 CDD:319539 12/44 (27%)
IBR 243..311 CDD:307574 18/69 (26%)
IBR <342..374 CDD:307574 21/32 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 241 1.000 Inparanoid score I684
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000641
OrthoInspector 1 1.000 T634496
orthoMCL 1 0.900 OOG5_126891
Panther 1 1.100 O PTHR11685
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.