DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and ARI8

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_176722.2 Gene:ARI8 AraportID:AT1G65430 Length:567 Species:Arabidopsis thaliana

Alignment Length:541 Identity:155/542 (29%)
Similarity:238/542 (44%) Gaps:100/542 (18%)


  Fly     2 DSDIEMDMESDNDGEYDDDYDYYNTGEDCDVERLDPKRADPEYFEYECLTVEDIEKLLNERVEKL 66
            |||     |.|.||||:...|..:..:|....|...        .|..|:..||.||..:.:.::
plant    19 DSD-----EDDADGEYEFVDDAADDSDDLIFRRRQQ--------NYSVLSEADICKLQEDDISRI 70

  Fly    67 NTILQITPSLAKVLLLEHQW--NNV-----AVVEKYRQDANALLVTARIKPPSVAVTDTASTSAA 124
            :|:|.|:.:.:.:||..:.|  :.|     |..||.| ||..||....:..|:....|       
plant    71 STVLSISRNSSAILLRHYNWCVSRVHDEWFADEEKVR-DAVGLLEKPVVDFPTDGELD------- 127

  Fly   125 AASAQLLRLGSSGYKTTASATPQYRSQMCPVCASSQLGDKFYSLACGHSFCKDCWTIYFETQIFQ 189
                                        |.:|..:.|.||.::.||||.||..||..|..|.|..
plant   128 ----------------------------CGICFETFLSDKLHAAACGHPFCDSCWEGYITTAIND 164

  Fly   190 GISTQIGCMA-----QMCNVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFCPGPNC-- 247
            |    .||:.     ..|...|.:|:: .|:.....:.||..:..:.||:.:.:.::||.|.|  
plant   165 G----PGCLTLRCPDPSCRAAVGQDMI-NLLAPDKDKQKYTSYFVRSYVEDNRKTKWCPAPGCDY 224

  Fly   248 --QIIVQSSEISAKRAICKACHTGFCFRCGMDYHAPTDCQVIKKWLTKCADDSETANYISAHTKD 310
              ..:|.|......   |:.|:: ||:.|..:.|.|.||..:.||:.|.:.:||..|:|.|::|.
plant   225 AVNFVVGSGNYDVN---CRCCYS-FCWNCAEEAHRPVDCDTVSKWVLKNSAESENMNWILANSKP 285

  Fly   311 CPKCHICIEKNGGCNHMQCF-NCKHDFCWMCLGDWKTHGSE---YYECSRY----KDNPNIANES 367
            ||||...||||.||.|:.|. .||.:|||:|||.|..||.:   :|.|:||    :|......|.
plant   286 CPKCKRPIEKNQGCMHITCTPPCKFEFCWLCLGAWTEHGEKTGGFYACNRYEAAKQDGIYDETEK 350

  Fly   368 VHVQAREALKKYLHYYERWENHSKS-----LKLEQQTIDRLRQRINSKVMNGSGTWIDWQYLFNA 427
            ....|:.:|::|.||||||..:..|     |.|::...|.:.:..:.:....|    ..:::..|
plant   351 RREMAKNSLERYTHYYERWATNQSSRQKALLDLKKMQTDDIEKLSDIQCQPES----QLKFIIEA 411

  Fly   428 AALLAKCRYTLQYTYPYAYYM---EAGSRKNLFEYQQAQLEAEIENLSWKIERAETTDLGDLENQ 489
            ...:.:||..|::||.|.:|:   |.|.|. .|||.|.:.|:.:|.|....|:.....|......
plant   412 WLQIVECRRVLKWTYAYGFYIPDQEHGKRV-FFEYLQGEAESGLERLHQCAEKELLPYLDAKGPS 475

  Fly   490 MDIAEKRR-----TTLLKDFF 505
            .|..|.|.     |::.|::|
plant   476 EDFNEFRTKLAGLTSVTKNYF 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763 18/66 (27%)
ARI8NP_176722.2 IBR 197..259 CDD:214763 18/66 (27%)
IBR <281..320 CDD:279784 22/39 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D469819at2759
OrthoInspector 1 1.000 T32278
orthoMCL 1 0.900 OOG5_126891
Panther 1 1.100 O PTHR11685
Phylome 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.