DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and ARI12

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001184919.1 Gene:ARI12 AraportID:AT1G05880 Length:496 Species:Arabidopsis thaliana

Alignment Length:511 Identity:122/512 (24%)
Similarity:207/512 (40%) Gaps:111/512 (22%)


  Fly     1 MDSDIEMDMESDNDGEYDDDYDYYNTG-EDCDVERLDPKRADPEYFEY-ECLTVEDIEKLLNERV 63
            ||::..:..|.|.:.    |..|.|.. ||....:...:|      .| ..||.|||..|:...|
plant     1 MDNNSVIGSEVDAEA----DESYVNAALEDGQTGKKSVQR------NYATVLTEEDIRALMEIDV 55

  Fly    64 EKLNTILQITPSLAKVLLLEHQWNNVAVVEKYRQDANALLVTARIKPPSVAVTDTASTSAAAASA 128
            :.::....::.:.|.:||...:||...:.:::                      :|...:...|.
plant    56 QSVSDFTSLSKAEATLLLSHLRWNVDCICKQW----------------------SAGAQSVRDSV 98

  Fly   129 QLLRLGSSGYKTTASATPQYRSQMCPVCASSQLGDKFYSLACGHSFCKDCWTIYFETQIFQGIST 193
            .||.|      ...|...:|   .|..|..|.......|::|||..|..|||.:....|.:..:.
plant    99 GLLEL------DPPSDDNEY---FCGACGESHPHKNLASVSCGHRICTRCWTSHINKIISEKPAA 154

  Fly   194 QIGCMAQMCNVRV------PEDLVLTLVTR-PVMRDK--YQQFAFKDYVKSHPELRFCP--GPNC 247
            :.....: |.|||      |..:.|..:.| ...|:|  |.|:..:.||.:...:::.|  |..|
plant   155 EWNLWLK-CPVRVGLHASCPASVGLDTIERFASKREKFNYNQYLLRSYVDNRETMKWHPIQGSRC 218

  Fly   248 QIIVQSSEISAKRAICKACH--TGFCFRCGMDYHAPTDCQVIKKWLTKCADDSETANYISAHTKD 310
            .|.:.....:|.    .:||  ..||:.|..|.|:|.||:...|||.:             :...
plant   219 AIDLSPGSGNAS----VSCHRLVRFCWNCREDAHSPVDCKTAAKWLLE-------------NAVP 266

  Fly   311 CPKCHICIEKN-GGCNHMQCFNCKHDFCWMCLGDW----KTHGSEYYECS--------RYKDNPN 362
            ||||.:.|.:| .....|:|..|.:.|||.|..||    :..|.:.:.|:        |.|.:.:
plant   267 CPKCKLRIPRNQDNSLKMKCLPCNYVFCWFCHVDWIEDMEGTGGDLHFCTFDAVLSDQRGKMSES 331

  Fly   363 IANESVHVQAREALKKYLHYYERWENHSKSLKLEQQTIDRL----RQRINSKVMNGSGTWIDWQY 423
            .:|            :|...||.|:::...::.||..:.:|    ::..|:::.|.|    ..::
plant   332 DSN------------RYEDCYENWDSNELLMQKEQANLPKLDTIIQELSNTQLENVS----QLKF 380

  Fly   424 LFNAAALLAKCRYTLQYTYPYAYYM---EAGSRKNLFEYQQAQLEAEIENLSWKIE 476
            :..|...:.:||..|::||.|.||:   |.| ::||.:..|.:|:..:|||...:|
plant   381 ILEAGLQIIECRRVLEWTYVYGYYLREDEVG-KQNLLKDTQERLKKFVENLKHCLE 435

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763 19/68 (28%)
ARI12NP_001184919.1 Zn_Tnp_IS91 <111..>139 CDD:291017 9/31 (29%)
IBR 193..253 CDD:214763 18/64 (28%)
IBR <266..301 CDD:303000 14/35 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D469819at2759
OrthoInspector 1 1.000 T32278
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11685
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.