DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and ARI13

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_201180.1 Gene:ARI13 AraportID:AT5G63750 Length:536 Species:Arabidopsis thaliana

Alignment Length:521 Identity:110/522 (21%)
Similarity:201/522 (39%) Gaps:119/522 (23%)


  Fly    35 LDPKRADPEYFEYECLTVEDIEKLLNERVEKLNTILQITPSLAKVLLLEHQWNNVAVVEKYRQDA 99
            ::..|..|    |..||.:.::..:.:::.:::.|..::...|.|||:..:|::..|.|...::.
plant     1 MENNREGP----YSVLTRDQLKGNMKKQIAEISEIFSLSKPDATVLLMFLRWDSHEVSEFLVENN 61

  Fly   100 NALLVTARIKPPSVAVTDTASTSAAAASAQLLRLGSSG--YKTTASATPQYRSQMCPVCASSQLG 162
            ..:|..:.:||   .|.|        .:..|.::.|.|  :||               |..   |
plant    62 EKVLSESGLKP---VVVD--------PNQDLYKISSCGICFKT---------------CDD---G 97

  Fly   163 DKFYSLA-CGHSFCKDCWTIYFETQIF--QGISTQIGCMAQMCNVRVPEDLVLTLVTRPVMRDKY 224
            |...|.. |.|.|||.||..|.|...:  :...|:|.|....|...|..|.:..|..  ..::.|
plant    98 DYLISTPFCSHMFCKSCWRKYLEKNFYLVEKTQTRISCPHGACQAAVGPDTIQKLTV--CDQEMY 160

  Fly   225 QQFAFKDYVKSHP--ELRFCPGPNCQIIVQ---------SSEISAKRAICKACHTGFCFRCGMDY 278
            .::..:.|::.:.  |:::||..:|..:::         ..|......:|...|. ||:||.::.
plant   161 VEYILRSYIEGNKVLEIKYCPAQDCNYVIEFHQKNHDGADQEDYGFNVVCLCGHI-FCWRCMLES 224

  Fly   279 HAPTDCQVIKKWLTK----------------CADDSETANY----ISAHTKDCPKCHICIEKNGG 323
            |.|..|.....||.:                .:.::....|    |.|..|.||.| :.....|.
plant   225 HKPVTCNNASDWLFRDLNSLSKESGEKPLSLSSFETREKTYPLSSIKATKKVCPHC-LRPADLGT 288

  Fly   324 CNHMQCFNCKHD--FCWMCLGDWKTHGSE--YYECSRYKDNPNIANESVHVQAREALKKYLHYYE 384
            ..:::...|..:  |||.|:...:.|.:|  :|:         ..|.|:..:.|  ..|.|....
plant   289 KQYLRFLTCACNGRFCWKCMQPEEAHKTESGFYK---------FCNVSMTFEGR--APKTLEGRA 342

  Fly   385 RWEN------HSKSLKLEQQTIDRLRQRINSKVMNGSG-TWIDWQYLFNAAALLAKCRYTLQYT- 441
            ..||      .:..:.|:|...| |:....|.:.|.|. |..|:..:.....|:.:||..|::: 
plant   343 EPENSCVGLWKASEVSLKQAKSD-LQAFEESNIKNPSDLTEKDFTIIRKGLMLIVQCRQVLKWSC 406

  Fly   442 -YPYAYYMEAGSRKNLFEYQQAQLEAEIEN----LSWKIERA-----------------ETTDLG 484
             |.|.:.....|::....:.||...:.:|:    |:.:|.||                 ||:::|
plant   407 VYDYLHAEYEMSKREYLRFLQADATSLVESFSKTLNEEIGRASSATYENFCCVKHKVTIETSNIG 471

  Fly   485 D 485
            :
plant   472 N 472

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763 15/73 (21%)
ARI13NP_201180.1 zf-RING_2 86..122 CDD:290367 17/54 (31%)
IBR 158..230 CDD:214763 15/73 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D469819at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11685
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.