DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and ARI14

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_201178.1 Gene:ARI14 AraportID:AT5G63730 Length:506 Species:Arabidopsis thaliana

Alignment Length:471 Identity:105/472 (22%)
Similarity:183/472 (39%) Gaps:92/472 (19%)


  Fly    47 YECLTVEDIEKLLNERVEKLNTILQITPSLAKVLLLEHQWNNVAVVEKYRQDANALLVTARIKPP 111
            |..||..:|...:.:::.:::.|..|:.|.|.|||:..:|:::.|.|:..::...||:.:.:|  
plant     9 YSVLTRNEITVKMKKQINEISDIFFISNSDATVLLMYLRWDSLRVSERLGENKEKLLMDSGLK-- 71

  Fly   112 SVAVTDTASTSAAAASAQLLRLGSSGYKTTASATPQYRSQMCPVCASSQLGDK-FYSLA-CGHSF 174
            ||.: |.:..|::..|.:               |..|...          ||. ..|:. |.|.|
plant    72 SVMI-DPSPDSSSEISLE---------------TDVYEFD----------GDNDLISMPFCSHKF 110

  Fly   175 CKDCWTIYFETQIF--QGISTQIGCMAQMCNVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHP 237
            ....|..|.|...:  :.|.|.|.|..|.|...|..|.:..|..|.  ::.|:::.::.|::.:.
plant   111 DSKYWREYLEKNFYYVEKIQTTISCPDQDCRSAVGPDTIEKLTVRD--QEMYERYIWRSYIEGNK 173

  Fly   238 EL--RFCPGPNCQIIV---QSSEISAKRAICKACHTG--FCFRCGMDYHAPTDCQVIKKWL---- 291
            .|  :.||..||..::   |.::...:.::...|..|  ||:||.::.|.|..|.....||    
plant   174 VLMIKQCPARNCDYVIEFHQENDDDDEYSLNVVCICGHIFCWRCRLESHRPVSCNKASDWLCSAT 238

  Fly   292 TKCADDSETANYISAHTKDCPKCHICIEKNGGCNHMQCFNCKHDFCWMCLGDWKTHGSEYYE--- 353
            .|.:|:|.:.......|..||.|...:|.:..........|:..||..||...:.|..|..:   
plant   239 MKISDESFSLYPTKTKTVTCPHCLCSLESDTKMPQFLTCVCRLRFCSRCLRSEEAHKIEAVDSGF 303

  Fly   354 CSR------YKDNPNIANESVHVQAREALKKYLHYYERWENHSKSLKLEQQTIDRLRQRINSKVM 412
            |.:      .:|..|:..:.:     |..|..|..:|.......|..|.:|.|..:|:.:     
plant   304 CIKTEVGILCEDRWNVCQKLL-----EQAKSDLEAFEETNIKKPSDLLREQDIMIIREGL----- 358

  Fly   413 NGSGTWIDWQYLFNAAALLAKCRYTLQYTYPYAYY-MEAGSRKNLFEYQQAQLEAEIENLSWKIE 476
                            .|:.:||..|::...|.|: .|..:.|....|.|....|.:::.|    
plant   359 ----------------MLIVQCRRVLKWCCVYDYFHTEYENSKEYLRYLQGNAIATLQSYS---- 403

  Fly   477 RAETTDLGDLENQMDI 492
                   ..|:.|.||
plant   404 -------NTLQEQKDI 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763 16/69 (23%)
ARI14NP_201178.1 IBR 158..227 CDD:214763 16/69 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D469819at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11685
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.