DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and ARI16

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_680158.1 Gene:ARI16 AraportID:AT5G08730 Length:500 Species:Arabidopsis thaliana

Alignment Length:433 Identity:98/434 (23%)
Similarity:186/434 (43%) Gaps:76/434 (18%)


  Fly    46 EYECLTVEDIEKLLNERVEKLNTILQITPSLAKVLLLEHQWNNVAVVEKYRQDANALLVTARIKP 110
            :|..|....:.:.:.:.:|:::.:..::.|.|.|:|:...||:....:....:....|       
plant     7 KYSVLAKTQVREKMMKEIEQISEVFLVSKSDATVILIRLGWNSFKASDLLGDNKEKFL------- 64

  Fly   111 PSVAVTDTASTSAAAASAQLLRLGSSGYKTTASATPQYRSQMCPVCASSQLGDKFYSLA---CGH 172
                        |....|::|...||.                   |..:.||..|.::   |.|
plant    65 ------------AKLGLARVLNSNSSS-------------------ADRETGDGDYLVSTPFCSH 98

  Fly   173 SFCKDCWTIYFETQIFQGISTQ--IGCMAQMCNVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKS 235
            .|...||:.|....:.:....:  |.|::|.|...|..|.:..| |.|| ::.|:.:..:.:::.
plant    99 KFSTTCWSEYLSDALKKNKEQRGLISCLSQDCVASVGPDTIEQL-TEPV-KEMYENYILESFMEC 161

  Fly   236 H-PELRFCPGPNCQIIVQ----SSEISAKRAICKACHTGFCFRCGMDYHAPTDCQVIKKWLTKCA 295
            | ..:::||...|:..|:    .:|.:....:|...|| ||:.||::.|.|..|:....|.|...
plant   162 HKATIKWCPASGCEYAVELQEDGNEDNVISVVCLCGHT-FCWTCGLESHRPVSCKKASIWWTYLL 225

  Fly   296 DDSETANYISAHTKDCPKCHICIEKNGGCNH--MQCFNCKHDFCWMCLGDWKTHGSEYYECSRYK 358
            |.|.:.::|..:||.||||.|.:::||..|:  :.|. |.::|||:||...:.|          :
plant   226 DQSRSISWIHTNTKSCPKCKIPVQQNGDPNYRLINCI-CSNNFCWICLRTEEQH----------Q 279

  Fly   359 DNPNIANESVHVQAREALK--KYLHYYERWENHSKSLKLEQQTIDRLRQRINSKVMNGSG-TWID 420
            .|.|.:..:|.......::  :.|| ...||...::||..:..:..|.::|..|::...| |.:|
plant   280 GNWNCSPVAVPAAGPSTVEFSQILH-LNLWEAGHEALKKAKSKLRALEEKIIPKLIENCGATELD 343

  Fly   421 WQYLFNAAALLAKCRYTLQYTYPYAYYMEAGSRKNLFEYQQAQ 463
            .:.:..|..|..:||..|:::..:.|        ::.||:..:
plant   344 IRTVREAGMLSVQCRQVLKWSCVFDY--------SIIEYESTK 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763 16/67 (24%)
ARI16NP_680158.1 IBR 148..214 CDD:214763 16/67 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D469819at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11685
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.