DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and ARI1

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_567966.1 Gene:ARI1 AraportID:AT4G34370 Length:597 Species:Arabidopsis thaliana

Alignment Length:505 Identity:162/506 (32%)
Similarity:242/506 (48%) Gaps:94/506 (19%)


  Fly    19 DDY-------DYYNT---------GEDCDVERLDPKRADPEYFEYECLTVEDIEKLLNERVEKLN 67
            |||       .||::         .|:.:::.|..||::.:....|.|.....|.||  ||.:| 
plant     2 DDYFSAEEEACYYSSDQDSLDGIDNEESELQPLSSKRSNTQVITQESLLAAQREDLL--RVMEL- 63

  Fly    68 TILQITPSLAKVLLLEHQWNNVAVVEK-----YRQDANALLVTARIKPPSVAVTDTASTSAAAAS 127
              |.|....|:.||:.:||:    |||     ..:..::|...|     .|.|.|          
plant    64 --LSIKEHHARTLLIHYQWD----VEKLFAVFVEKGKDSLFSGA-----GVTVFD---------- 107

  Fly   128 AQLLRLGSSGYKTTASATPQYRSQMCPVCASSQLGDKFYSLACGHSFCKDCWTIYFETQIFQGIS 192
                      |:...|:.||.....|.||.....||....:.|||.||.:|||.:|..||.:|.|
plant   108 ----------YQYGNSSFPQSSQMSCDVCMEDLPGDHMTRMDCGHCFCNNCWTEHFTVQINEGQS 162

  Fly   193 TQIGCMAQMCNVRVPEDLVLTLVT--RPVMRDKYQQFAFKDYVKSHPELRFCPG-PNCQIIVQSS 254
            .:|.|||..||....||:|.:||:  ||.:..|:.::..:.|::.:..:::||. |:|...:::.
plant   163 KRIRCMAHQCNAICDEDIVRSLVSKKRPDLAAKFDRYLLESYIEDNRMVKWCPSTPHCGNAIRAE 227

  Fly   255 EISAKRAICKACHTGFCFRCGMDYHAPTDCQVIKKWLTKCADDSETANYISAHTKDCPKCHICIE 319
            :.......| :|...|||.|....|:|..|.:.:.|..||.|:|||.|:|:.|||.||||:..:|
plant   228 DDKLCEVEC-SCGLQFCFSCLCQAHSPCSCLMWELWRKKCRDESETINWITVHTKLCPKCYKPVE 291

  Fly   320 KNGGCNHMQCFNCKHDFCWMCLGDWKTHGSEY-------YECSRYKDNPNIANESVHVQAREALK 377
            ||||||.::|. |...|||:|.|   ..||::       :.|.||:|:    .|....:|:..|.
plant   292 KNGGCNLVRCI-CGQCFCWLCGG---ATGSDHTYRSIAGHSCGRYQDD----KEKQMERAKRDLN 348

  Fly   378 KYLHYYERWENHSKSLKLEQQTIDRLRQRINSKVMNGSGTWI---DWQYLFNAAALLAKCRYTLQ 439
            :|.||:.|::.|:.|.|||    |:||..|:.||.......:   |:.::.|....|.:.|..|.
plant   349 RYTHYHHRYKAHTDSSKLE----DKLRDTIHEKVSKSEKRELKLKDFSWVTNGLDRLFRSRRVLS 409

  Fly   440 YTYPYAYYM-------------EAGSRKNLFEYQQAQLEAEIENLSWKIE 476
            |:|.:||||             |...:|||||.||.|||:.:|.||..:|
plant   410 YSYAFAYYMFGEEMFKDEMTPEEREIKKNLFEDQQQQLESNVEKLSQFLE 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763 14/63 (22%)
ARI1NP_567966.1 IBR 194..256 CDD:214763 14/63 (22%)
IBR <284..313 CDD:279784 16/30 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 260 1.000 Inparanoid score I946
OMA 1 1.010
OrthoDB 1 1.010 D469819at2759
OrthoInspector 1 1.000 T32233
orthoMCL 1 0.900 OOG5_126891
Panther 1 1.100 O PTHR11685
Phylome 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.