DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and ARI4

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_189409.1 Gene:ARI4 AraportID:AT3G27720 Length:493 Species:Arabidopsis thaliana

Alignment Length:521 Identity:131/522 (25%)
Similarity:211/522 (40%) Gaps:120/522 (23%)


  Fly     2 DSDIEMDMESDN--DGEYDDDYDYYNTGEDCDVERLDPKRADPEYFEYECLTVEDIEKLLNERVE 64
            |..:.::.|.||  ..|:||.....:..|:.|::.                        ..|...
plant     3 DEYMSLEEEEDNCYPSEFDDHDQMCSNAEESDLQH------------------------SREPTS 43

  Fly    65 KLNTILQITPSLAKVLLLEHQWNNVAVVEKYRQDANALLVTARIKPPSVAVTDTASTSAAAASAQ 129
            ::...|.:|.:.|:.||:::|||...:...|......:|.       |.|..:...........:
plant    44 QVMEFLSVTENQARTLLIQYQWNVDKLFSVYTDQGKDVLF-------SRAEEEEGEDKEEEEGGE 101

  Fly   130 LLRLGSSGYKTTASATPQYRSQMCPVCASSQLGDKFYSLACGHSFCKDCWTIYFETQIFQGISTQ 194
            .......|....|....:.......|....:..|:           ||     .|.|:   :||:
plant   102 DEEEEEGGEDEEAEEGGEDEEAEEGVEDEEEEEDE-----------KD-----DEVQL---VSTE 147

  Fly   195 IGCMAQMCNVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFCPG-PNCQIIVQS--SEI 256
            :.                         :|:.:|..:.||:.:..:::||. |:|...:::  .:.
plant   148 LA-------------------------EKFDRFLIESYVEDNNMVKWCPSTPHCGNAIRNIKDDG 187

  Fly   257 SAKRAICKACHTGFCFRCGMDYHAPTDCQVIKKWLTKCADDSETANYISAHTKDCPKCHICIEKN 321
            ......| :|...|||.|..:.|:|..|.:.|.|..||.|:|||.|:::.:||.||||...|:|.
plant   188 DVDEVEC-SCGLQFCFSCLSESHSPCSCLMWKLWKKKCEDESETVNWMTVNTKLCPKCSKPIQKR 251

  Fly   322 GGCNHMQCFNCKHDFCWMCLGDWKTHGSEY-----YECSRYKDNPNIANESVH--VQAREALKKY 379
            .|||||.| .|...|||:| |........|     :.|.|||:      |.|.  .:|:..|.:|
plant   252 DGCNHMTC-KCGQHFCWLC-GQATGRDHSYSSIAGHSCGRYKE------EKVRQLERAQRDLDRY 308

  Fly   380 LHYYERWENHSKSLKLEQQTIDRLRQRINSKVMNGSGT-----WIDWQYLFNAAALLAKCRYTLQ 439
            .||:.|::.|..|||||    |:|::.|..|.:..|.|     :.::.::.:|...|.:.|..|.
plant   309 THYHYRYKAHIDSLKLE----DKLKKSILKKAVLNSETKDQKVFKEYSWIIDAVNRLFRSRRILS 369

  Fly   440 YTYPYAYYM-------------EAGSRKNLFEYQQAQLEAEIENLSWKIERAETTDLGDLENQMD 491
            |:||:.:||             |...:|||||.||.|||..:|.||..:|  |..|..|.|..::
plant   370 YSYPFVFYMFGKELFKDDMSDEERNIKKNLFEDQQQQLEGNVERLSKILE--EPFDEYDHEKVVE 432

  Fly   492 I 492
            :
plant   433 M 433

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763 16/65 (25%)
ARI4NP_189409.1 IBR 150..214 CDD:214763 16/65 (25%)
IBR <237..271 CDD:279784 20/36 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 260 1.000 Inparanoid score I946
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D469819at2759
OrthoInspector 1 1.000 T32233
orthoMCL 1 0.900 OOG5_126891
Panther 1 1.100 O PTHR11685
Phylome 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.