DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and ARI9

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_180736.1 Gene:ARI9 AraportID:AT2G31770 Length:543 Species:Arabidopsis thaliana

Alignment Length:516 Identity:151/517 (29%)
Similarity:238/517 (46%) Gaps:57/517 (11%)


  Fly     8 DMESDNDGEYDDDYDYYNTGEDCD----VERLDPKRADPEYFEYECLTVEDIEKLLNERVEKLNT 68
            ||..:..||  ::|.|....|..|    |:.:.|...     .|..|..|||.||..:.:|::::
plant     7 DMIDNKSGE--ENYSYGGGNESDDYNDVVDTIIPSEK-----SYVILKEEDILKLQRDDIERVSS 64

  Fly    69 ILQITPSLAKVLLLEHQWNNVAVVEKYRQDANAL-LVTARIKPPSVAVTDTASTSAAAASAQLLR 132
            ||.::.....||||.:.|....|.:::..|...: .....:|.|.|...                
plant    65 ILSLSQVEVIVLLLHYNWCVSKVEDEWFTDEERIRKAVGLLKEPVVDFN---------------- 113

  Fly   133 LGSSGYKTTASATPQYRSQMCPVCASSQLGDKFYSLACGHSFCKDCWTIYFETQIFQGIS-TQIG 196
             |....|.......|     |.:|..|...::...::|||.:||.||..|..|:|..|.. .::.
plant   114 -GGEKDKKCRKVNIQ-----CGICFESYTREEIARVSCGHPYCKTCWAGYITTKIEDGPGCLRVK 172

  Fly   197 CMAQMCNVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFCPGPNCQIIVQ--SSEISAK 259
            |....|:..|.:|::.. ||...:.:||.::..:.||:...::::||.|.|...|:  .||.|:.
plant   173 CPEPSCSAAVGKDMIED-VTETKVNEKYSRYILRSYVEDGKKIKWCPSPGCGYAVEFGGSESSSY 236

  Fly   260 RAICKACHTGFCFRCGMDYHAPTDCQVIKKWLTKCADDSETANYISAHTKDCPKCHICIEKNGGC 324
            ...| .|...||:.|..|.|:|.||..:.||:.|..|:||..|::.|::|.||:|...||||.||
plant   237 DVSC-LCSYRFCWNCSEDAHSPVDCDTVSKWIFKNQDESENKNWMLANSKPCPECKRPIEKNDGC 300

  Fly   325 NHMQC-FNCKHDFCWMCLGDWKTHGSEYYECSRYKDNPNIANESVHVQAREALKKYLHYYERW-E 387
            |||.| ..|.|:|||:||..::.|..   .|:|:...   ..||.....:..:|:|.|||.|| |
plant   301 NHMTCSAPCGHEFCWICLKAYRRHSG---ACNRFVVE---QAESKRALLQSEIKRYTHYYVRWAE 359

  Fly   388 NHSKSLKLEQQTIDRLRQRINSKVMNGSGTWIDWQYLFNAAALL--AKCRYTLQYTYPYAYYMEA 450
            |.|..|| ..:.:::| |.:..|.::.:....:.|..|...|.|  .:||..|::||.|.||::.
plant   360 NQSSRLK-AMRDLEKL-QSVQLKELSDNQCTSETQLQFTVDAWLQIIECRRVLKWTYAYGYYLQD 422

  Fly   451 GSRKNLFEYQQAQLEAEIENLSWKIER------AETTDLGDLENQMDIAEKRRTTLLKDFF 505
            ..::..|||.|.:.|:.:|.|....|.      .::.|..|..|...:.....||:.|.:|
plant   423 LPKRKFFEYLQGEAESGLERLHHCAENELKQFFIKSEDPSDTFNAFRMKLTGLTTVTKTYF 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763 21/64 (33%)
ARI9NP_180736.1 IBR 197..260 CDD:214763 21/64 (33%)
IBR <282..326 CDD:279784 23/44 (52%)
DUF2313 426..>504 CDD:294914 15/59 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D469819at2759
OrthoInspector 1 1.000 T32278
orthoMCL 1 0.900 OOG5_126891
Panther 1 1.100 O PTHR11685
Phylome 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.