DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and ARI7

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_180709.3 Gene:ARI7 AraportID:AT2G31510 Length:562 Species:Arabidopsis thaliana

Alignment Length:559 Identity:152/560 (27%)
Similarity:252/560 (45%) Gaps:108/560 (19%)


  Fly     1 MDSDIEM----DMESDNDGEYDDDYDYYNTG-EDCDVERLDPKRADPEYFEYE------------ 48
            |||:.:|    ||||..|       |:|:.| :||:    |....:|:|...|            
plant     1 MDSEEDMLDAHDMESGED-------DFYSGGTDDCN----DSDDGEPDYGFVEEDADDSAMIASH 54

  Fly    49 ------C-LTVEDIEKLLNERVEKLNTILQITPSLAKVLLLEHQWNNVAVVEKYRQDANAL---- 102
                  | |..|||.:...:.:|:::.:|.||...|.:||....|:...|.:::..|...:    
plant    55 RSQKNFCVLREEDIRRHQMDNIERVSVVLSITEVEASILLRHFHWSVGRVHDEWFADEERVRKTV 119

  Fly   103 -LVTARIKPPSVAVTDTASTSAAAASAQLLRLGSSGYKTTASATPQYRSQMCPVCASSQLGDKFY 166
             ::.:.:.|||   .|:..|                               |.:|..|...:|..
plant   120 GILESHVVPPS---DDSELT-------------------------------CGICFDSYPPEKIA 150

  Fly   167 SLACGHSFCKDCWTIYFETQIFQGIS-TQIGCMAQMCNVRVPEDLVLTLVTRPVMRDKYQQFAFK 230
            |::|||.||..|||.|..|.|..|.. ..:.|....|...|..|:|..|.:.. .::||.::..:
plant   151 SVSCGHPFCTTCWTGYISTTINDGPGCLMLRCPDPSCLAAVGHDMVDKLASED-EKEKYNRYFLR 214

  Fly   231 DYVKSHPELRFCPGPNCQIIVQSSEISAKRAICKACHTGFCFRCGMDYHAPTDCQVIKKWLTKCA 295
            .|::.:.::::||.|.|...:.....|....:...|...||:.|..:.|.|.||..:.||:.|.:
plant   215 SYIEDNRKMKWCPAPGCDFAIDFVAGSGNYDVSCLCSFSFCWNCTEEAHRPVDCSTVSKWILKNS 279

  Fly   296 DDSETANYISAHTKDCPKCHICIEKNGGCNHMQCF-NCKHDFCWMCLGDWKTHGSE---YYECSR 356
            .:||..|:|.|::|.||:|...||||.||.||.|. .||::|||:|||.|..||..   :|.|:|
plant   280 AESENMNWILANSKPCPRCKRPIEKNQGCMHMTCTPPCKYEFCWLCLGAWMDHGERTGGFYACNR 344

  Fly   357 Y----KDNPNIANESVHVQAREALKKYLHYYERWENHSKSLK-----LEQQTIDRLRQRINSKVM 412
            |    ::......|.....|:.:|::|.||||||.::..|.:     |:|..:..| ::::.|..
plant   345 YEVAKQEGQYDETERRREMAKNSLERYTHYYERWASNQTSRQKAMADLQQAQMQNL-EKLSDKQC 408

  Fly   413 NGSGTWIDWQYLFNAAALLAKCRYTLQYTYPYAYYM--EAGSRKNLFEYQQAQLEAEIENLSWKI 475
            ....   ..:::..|...:.:||..|::||.|.||:  ...:::..|||.|.:.|:.:|.|...:
plant   409 TPES---QLKFILEAWLQIIECRRVLKWTYAYGYYLPEHEHAKRQFFEYLQGEAESGLERLHQCV 470

  Fly   476 ER-------AE--TTDLGDLENQMDIAEKRRTTLLKDFF 505
            |:       ||  :.|..|...::    ...|::.|::|
plant   471 EKDLVQFLIAEGPSKDFNDFRTKL----AGLTSVTKNYF 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763 15/62 (24%)
ARI7NP_180709.3 IBR 206..268 CDD:214763 15/62 (24%)
IBR <290..329 CDD:279784 22/39 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D469819at2759
OrthoInspector 1 1.000 T32278
orthoMCL 1 0.900 OOG5_126891
Panther 1 1.100 O PTHR11685
Phylome 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.