DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and ARI2

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_179206.2 Gene:ARI2 AraportID:AT2G16090 Length:593 Species:Arabidopsis thaliana

Alignment Length:507 Identity:155/508 (31%)
Similarity:244/508 (48%) Gaps:86/508 (17%)


  Fly     9 MESDNDGEYDDDYDYYNTGEDCDVERL-----DPKRADPEYFEYECLTVEDIEKLL---NERVEK 65
            |:.:..|| ::|| ||::    |.|.|     |...:.|.......:.|...|.||   .|.:.:
plant     1 MDDNLSGE-EEDY-YYSS----DQESLNGIDNDESVSIPVSSRSNTVKVITKESLLAAQREDLRR 59

  Fly    66 LNTILQITPSLAKVLLLEHQWNNVAVVEKYRQDANALLVTARIKPPSVAVTDTASTSAAAASAQL 130
            :..:|.:....|:.||:.::|:    |||..               :|.|.....:..:.|...|
plant    60 VMELLSVKEHHARTLLIHYRWD----VEKLF---------------AVLVEKGKDSLFSGAGVTL 105

  Fly   131 LRLGSSGYKTTASATPQYRSQMCPVCASSQLGDKFYSLACGHSFCKDCWTIYFETQIFQGISTQI 195
            |...|.....:.|::    ...|.:|.....|.:...:.||||||.:|||.:|..:|.:|.|.:|
plant   106 LENQSCDSSVSGSSS----MMSCDICVEDVPGYQLTRMDCGHSFCNNCWTGHFTVKINEGQSKRI 166

  Fly   196 GCMAQMCNVRVPEDLVLTLVTR--PVMRDKYQQFAFKDYVKSHPELRFCPG-PNC--QIIVQSSE 255
            .|||..||....||:|..||::  |.:.:|:.:|..:.|::.:..:::||. |:|  .|.|:..|
plant   167 ICMAHKCNAICDEDVVRALVSKSQPDLAEKFDRFLLESYIEDNKMVKWCPSTPHCGNAIRVEDDE 231

  Fly   256 ISAKRAICK---ACHTGFCFRCGMDYHAPTDCQVIKKWLTKCADDSETANYISAHTKDCPKCHIC 317
                  :|:   :|...|||.|....|:|..|.:.:.|..||.|:|||.|:|:.|||.|||||..
plant   232 ------LCEVECSCGLQFCFSCSSQAHSPCSCVMWELWRKKCFDESETVNWITVHTKPCPKCHKP 290

  Fly   318 IEKNGGCNHMQCFNCKHDFCWMCLGDWKTHGSEY-------YECSRYKDNPNIANESVHVQAREA 375
            :|||||||.:.|. |:..|||:|   .:..|.::       :.|.|::::    .|....:|:..
plant   291 VEKNGGCNLVTCL-CRQSFCWLC---GEATGRDHTWARISGHSCGRFQED----KEKQMERAKRD 347

  Fly   376 LKKYLHYYERWENHSKSLKLEQQTIDRLRQRINSKVMNGSGTWI---DWQYLFNAAALLAKCRYT 437
            ||:|:||:.|::.|..|.|||.    :|...|:.||.......:   |:.:..|....|.:.|..
plant   348 LKRYMHYHNRYKAHIDSSKLEA----KLSNNISKKVSISEKRELQLKDFSWATNGLHRLFRSRRV 408

  Fly   438 LQYTYPYAYYM-------------EAGSRKNLFEYQQAQLEAEIENLSWKIE 476
            |.|:||:|:||             |...::||||.||.||||.:|.||..:|
plant   409 LSYSYPFAFYMFGDELFKDEMSSEEREIKQNLFEDQQQQLEANVEKLSKFLE 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763 18/68 (26%)
ARI2NP_179206.2 IBR 195..257 CDD:214763 18/68 (26%)
IBR <283..314 CDD:279784 18/35 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 260 1.000 Inparanoid score I946
OMA 1 1.010
OrthoDB 1 1.010 D469819at2759
OrthoInspector 1 1.000 T32233
orthoMCL 1 0.900 OOG5_126891
Panther 1 1.100 O PTHR11685
Phylome 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.