DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and Cul7

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_079887.3 Gene:Cul7 MGIID:1913765 Length:1689 Species:Mus musculus

Alignment Length:554 Identity:92/555 (17%)
Similarity:150/555 (27%) Gaps:248/555 (45%)


  Fly    64 EKLNTILQITPSLAKVLLLEHQ---WNNVAVVEKYRQDANALLVTARIKPPSVAVTDTASTSAAA 125
            ::|||: .:.||.::|.|||:.   |..:.:..|..|...   :..||:...|.           
Mouse   897 KELNTV-NVMPSASRVTLLENLTRFWPIIQIRIKRCQQGG---INTRIRGLEVL----------- 946

  Fly   126 ASAQLLRLGSSGYKTTASATPQYRSQMCPVCASSQLGDKFYSLACGHSFCKDCWTIYFETQIFQG 190
                       |.|.|  ..|.:|.|:|.                             .|::|..
Mouse   947 -----------GPKPT--FWPVFREQLCR-----------------------------HTRLFYM 969

  Fly   191 ISTQIGCMAQMCNVRVPED----LVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFCPGPNCQIIV 251
            :      .||..:..:.||    |.|:......:|.: |.||          .||.|        
Mouse   970 V------RAQAWSQDIAEDRRSLLHLSSRLNGALRHE-QNFA----------ERFLP-------- 1009

  Fly   252 QSSEISAKRAICKACHTGFCFRCGMDYHAP-TDCQVIKKWLTK----CAD-----DSETANY--- 303
               ::.|.:|:.|.|..........:..:| .|......||..    |.:     .|..|.:   
Mouse  1010 ---DMEAAQALSKTCWEALVSPLVQNITSPDEDSTSSLGWLLDQYLGCREAAYNPQSRAAAFSSR 1071

  Fly   304 --------ISAHTKDCPKCHICIEKNGGCNHMQCFNCKHDF------------------CWMCL- 341
                    :....::.....:.|.::.|.|.:      ||:                  ||..: 
Mouse  1072 VRRLTHLLVHVEPREAAPPVVAIPRSKGRNRI------HDWSYLITRGLPSSIMKNLTRCWRSVV 1130

  Fly   342 ---------GDWKTHGSEYYECSRY----KDN-----PNIA------NESVHVQAREALKKYLHY 382
                     ..||........|.||    |.:     |..|      |.......|....:..|.
Mouse  1131 EEQMNKFLTASWKDDDFVPRYCERYYVLQKSSSELFGPRAAFLLAMRNGCADAVLRLPFLRAAHV 1195

  Fly   383 YERWENHSKSLKLEQQTIDRLRQRINSKVMNGSGTWIDWQYLFNAAALLAKCRYTLQ-------- 439
            .|::..|          ||   |||....|.|:          ....:||:.:..|:        
Mouse  1196 SEQFARH----------ID---QRIQGSRMGGA----------RGMEMLAQLQRCLESVLIFSPL 1237

  Fly   440 -----YTYPYAYYM-----EAGS---------------------------------RKNLFEYQQ 461
                 :.:.|.:||     ..||                                 ::....||.
Mouse  1238 EIATTFEHYYQHYMADRLLSVGSSWLEGAVLEQIGPCFPSRLPQQMLQSLNVSEELQRQFHVYQL 1302

  Fly   462 AQLEAEIENLSWKIERAETTDLGDLENQMDIAEK 495
            .||:.|:..|.            |.|.::.:|.:
Mouse  1303 QQLDQELLKLE------------DTEKKIQVAHE 1324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763 12/63 (19%)
Cul7NP_079887.3 Interaction with TP53. {ECO:0000250} 349..449
Cul7 352..423 CDD:288381
APC10-like 817..947 CDD:295192 15/76 (20%)
Cullin_Nedd8 1552..1630 CDD:299553
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.