DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and ankib1a

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001074461.1 Gene:ankib1a ZFINID:ZDB-GENE-060503-156 Length:1060 Species:Danio rerio

Alignment Length:544 Identity:144/545 (26%)
Similarity:249/545 (46%) Gaps:107/545 (20%)


  Fly     4 DIEMDMESDN-----DGEYDDDYDYYNTGEDCDVERLDPKRADPEYFEYECLTVEDIEKLLNERV 63
            |:.:.:||..     .|..:.:.:|      ..::|.:|         ||.|.::|:.:|.:..:
Zfish   193 DLALSLESQMVFSQVPGAQEIEAEY------AALDRREP---------YEGLKLQDLRRLKDMLI 242

  Fly    64 EKLNTILQITPSLAKVLLLEHQWNNVAVVEKYRQDANALLVTARIKPPSVAVTDTASTSAAAASA 128
            .:...:||.....|:.||..|.|:...::|.:..:|......:.::.|:..              
Zfish   243 VETADMLQAPLFTAEALLRAHDWDREKLLEDWMSNAEECCQRSGVQMPTPP-------------- 293

  Fly   129 QLLRLGSSGY------------KTTASA----------TPQYRSQMCPVCASS-QLGDKFYSLAC 170
                  .|||            :||.|:          :|.....:|.:|.|| .:.:....::|
Zfish   294 ------PSGYNAWDTLPSPRTPRTTRSSVTSPDEISLLSPTDGLALCGICMSSISVFEDPVDMSC 352

  Fly   171 GHSFCKDCWTIYFETQIFQGISTQIGCMAQMCNVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKS 235
            ||.||:.||..:...:|.:|.:..|.|.|..|...||.:::.::|:|. |..:|.||..|.:|.:
Zfish   353 GHEFCRACWEGFLNLKIQEGEAHNIFCPAYDCFQLVPVEVIESVVSRE-MDKRYLQFDIKAFVDN 416

  Fly   236 HPELRFCPGPNCQIIVQSSE-------------ISAKRAICKACHTGFCFRCGMDYHAPTDCQVI 287
            :|.:.:||...|:..|:.:.             :.|....|...|. ||:.|..|.|.|.||:..
Zfish   417 NPAIHWCPVARCERAVRLTRPGPGASDPLSFPLLKAPAVDCGKGHL-FCWECLGDAHEPCDCETW 480

  Fly   288 KKWLTKCA--------------DDSETANYISAHTKDCPKCHICIEKNGGCNHMQCFNCKHDFCW 338
            |.||.|.:              :|:....::.:::|.|..|...|:||.|||||||..||:||||
Zfish   481 KMWLQKVSEMKPEELAGVSEAYEDAANCLWLLSNSKPCANCKSPIQKNEGCNHMQCAKCKYDFCW 545

  Fly   339 MCLGDWKTHGSE---YYECSRYKDNPNIANES--VHVQAR------EALKKYLHYYERWENHSKS 392
            :||.:||.|.|.   ||.|:||:....:..:|  :.|:|.      :.|.:::|||.|::||..|
Zfish   546 ICLEEWKKHSSSTGGYYRCTRYEVIQQVEEQSKEMTVEAEKKHKSFQELDRFMHYYTRYKNHEHS 610

  Fly   393 LKLEQQTIDRLRQRIN--SKVMNG-SGTWIDWQYLFNAAALLAKCRYTLQYTYPYAYYMEAGS-R 453
            .:||::.:...::::.  ||...| .|...|..::.:....|.|.|..|:.:|||::::|..| :
Zfish   611 YQLEERLLKTAKEKMEQLSKAFIGRDGAPPDTTFIEDGVHELLKTRRILKCSYPYSFFLEPKSTK 675

  Fly   454 KNLFEYQQAQLEAEIENLSWKIER 477
            |.:||..|..||...|:|:.|:.|
Zfish   676 KEIFELMQTDLEMVTEDLAQKVNR 699

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763 20/75 (27%)
ankib1aNP_001074461.1 ANK 1 45..75
ANK 47..198 CDD:238125 1/5 (20%)
ANK repeat 47..77 CDD:293786
ANK repeat 79..143 CDD:293786
Ank_5 133..186 CDD:290568
ANK repeat 145..176 CDD:293786
ANK 2 145..174
TRIAD supradomain. {ECO:0000255|PROSITE-ProRule:PRU01221} 330..568 78/240 (33%)
zf-RING_2 334..380 CDD:290367 15/46 (33%)
IBR 403..477 CDD:214763 20/75 (27%)
IBR 500..551 CDD:279784 22/51 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D429758at33208
OrthoFinder 1 1.000 FOG0000641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.