DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and arih2

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_998308.1 Gene:arih2 ZFINID:ZDB-GENE-040426-2158 Length:492 Species:Danio rerio

Alignment Length:511 Identity:277/512 (54%)
Similarity:352/512 (69%) Gaps:40/512 (8%)


  Fly     2 DSDIEMDMESDNDGEYDDDYDYYNTGEDCDVERLDPKRADPEYFEYECLTVEDIEKLLNERVEKL 66
            ||:.|.:.:.::.||.|..:.|.|..||..||  :|  .|||.:::.|||..:.:::|.|:|..:
Zfish    11 DSNEEFEDDDEDIGEGDIPHYYDNLEEDVAVE--EP--FDPEKYQFNCLTYRESQRVLTEQVNNV 71

  Fly    67 NTILQITPSLAKVLLLEHQWNNVAVVEKYRQDANALLVTARIKPPSVAVTDTASTSAAAASAQLL 131
            .:.|:::|::||::|:...|..|.::|:|:.:::.||..|..:|.:...:.||.||.        
Zfish    72 ASALKVSPAVAKLVLVHFHWQVVQILERYKSNSSQLLCEAYAQPTTTCRSLTAGTSL-------- 128

  Fly   132 RLGSSGYKTTASATPQYRSQMCPVCASSQLGDKFYSLACGHSFCKDCWTIYFETQIFQGISTQIG 196
                                .|.||......|...||.|.|||||.||..:....:..|:..:|.
Zfish   129 --------------------QCGVCLQLVRRDALLSLPCQHSFCKGCWEQHCTVLVKDGVGVEIS 173

  Fly   197 CMAQMCNVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFCPGPNCQIIVQSSEISAKRA 261
            ||||.|::|:|||.||.|:....::|||:::.|:|||:||.:|:.|||.:|.|::|..|..|:|.
Zfish   174 CMAQDCSLRMPEDFVLPLLPSEELKDKYRRYLFRDYVESHFQLQLCPGADCPIVIQVQEPRARRV 238

  Fly   262 ICKACHTGFCFRCGMDYHAPTDCQVIKKWLTKCADDSETANYISAHTKDCPKCHICIEKNGGCNH 326
            .|..|...|||:|...|||||||..|:||||||||||||||||||||||||||:|||||||||||
Zfish   239 QCSRCEEVFCFKCRQMYHAPTDCATIRKWLTKCADDSETANYISAHTKDCPKCNICIEKNGGCNH 303

  Fly   327 MQCFNCKHDFCWMCLGDWKTHGSEYYECSRYKDNPNIANESVHVQAREALKKYLHYYERWENHSK 391
            |||..|||||||||||||||||||||||||||:||:|.|:|...||||||||||.|:||||||:|
Zfish   304 MQCSKCKHDFCWMCLGDWKTHGSEYYECSRYKENPDIVNQSQQAQAREALKKYLFYFERWENHNK 368

  Fly   392 SLKLEQQTIDRLRQRINSKVMNGSGTWIDWQYLFNAAALLAKCRYTLQYTYPYAYYMEAGSRKNL 456
            ||:||.||..|::::|..:|||..|||||||||.|||.||||||||||||||||||||:|.||.|
Zfish   369 SLQLEAQTYQRIQEKIQERVMNNLGTWIDWQYLQNAAKLLAKCRYTLQYTYPYAYYMESGPRKKL 433

  Fly   457 FEYQQAQLEAEIENLSWKIERAET--------TDLGDLENQMDIAEKRRTTLLKDF 504
            ||||||||||||||||||:|||:|        .|.|||||||.|||::|.||||||
Zfish   434 FEYQQAQLEAEIENLSWKVERADTYERGEPSANDRGDLENQMHIAEQKRRTLLKDF 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763 31/62 (50%)
arih2NP_998308.1 IBR 199..261 CDD:214763 31/62 (50%)
IBR <289..321 CDD:279784 29/32 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C252069719
eggNOG 1 0.900 E1_KOG1812
Hieranoid 1 1.000
Homologene 1 1.000 H48424
Inparanoid 1 1.050 579 1.000 Inparanoid score I973
OMA 1 1.010
OrthoDB 1 1.010 D429758at33208
OrthoFinder 1 1.000 FOG0000641
OrthoInspector 1 1.000 T1051934
orthoMCL 1 0.900 OOG5_126891
Panther 1 1.100 LDO PTHR11685
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2404
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.