DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and arih1l

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_998088.1 Gene:arih1l ZFINID:ZDB-GENE-040426-2395 Length:533 Species:Danio rerio

Alignment Length:546 Identity:174/547 (32%)
Similarity:278/547 (51%) Gaps:79/547 (14%)


  Fly     7 MDMESDNDGEYDDDYDYYNTGEDC-----------------DVERLDPKRA-------------- 40
            ||.:...:.|:||:.:.....|:|                 :||.|||..|              
Zfish     1 MDSDEGYNYEFDDEEEEEEEEEECSVDSGEEEAVDDSLELGEVELLDPAVAGGEPDDCADTGGGG 65

  Fly    41 -----DPEYFEYECLTVEDIEKLLNERVEKLNTILQITPSLAKVLLLEHQWNNVAVVEKYRQDAN 100
                 :.|.:.:|.||.|.|.:.:.|.:..:|.::|...::.::||....|:...::|:| .|.|
Zfish    66 PGPGQEDEDYRFEVLTTEQILQHMVECIRDVNEVIQNPATITRILLSHFNWDKEKLMERY-FDGN 129

  Fly   101 --ALLVTARI----KPPSVAVTDTASTSAAAASAQLLRLGSSGYKTTASATPQYRSQMCPVCASS 159
              .|.....:    |.|......|.|:|                          :...|.:|..:
Zfish   130 LDKLFSECHVINPSKKPKTRPMSTRSSS--------------------------QDLPCQICYLN 168

  Fly   160 QLGDKFYSLACGHSFCKDCWTIYFETQIF-QGISTQIGCMAQMCNVRVPEDLVLTLVTRPVMRDK 223
            .....|..|.|||.||..||..|..|:|. :|:...|.|.|..|::.|.::.|:.|:|...::.|
Zfish   169 YPNSYFTGLECGHKFCMQCWGDYLTTKIIEEGMGQTISCPAHNCDILVDDNTVMRLITDSKVKLK 233

  Fly   224 YQQFAFKDYVKSHPELRFCPGPNCQIIVQSSEISAKRAICKACHTGFCFRCGMDYHAPTDCQVIK 288
            ||......:|:.:..|::||.|:|..:|:.....||...|| |...|||.||.::|.|..|:.::
Zfish   234 YQHLITNSFVECNRLLKWCPAPDCHHVVKVQYPDAKPVRCK-CGRQFCFNCGENWHDPVKCKWLR 297

  Fly   289 KWLTKCADDSETANYISAHTKDCPKCHICIEKNGGCNHMQC--FNCKHDFCWMCLGDWKTHGSEY 351
            ||:.||.|||||:|:|:|:||:|||||:.|||:||||||.|  .|||.:|||:|||.|:.|||.:
Zfish   298 KWIKKCDDDSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHGSAW 362

  Fly   352 YECSRYKDNPNIANESVHVQAREALKKYLHYYERWENHSKSLKLEQQTIDRLRQRINSKVMNGSG 416
            |.|:||.::...|......::|.||::||.|..|:.||.:||:.|.:...:::|:: .::...:.
Zfish   363 YNCNRYNEDDAKAARDAQERSRAALQRYLFYCNRYMNHMQSLRFEHKLYAQVKQKM-EEMQQHNM 426

  Fly   417 TWIDWQYLFNAAALLAKCRYTLQYTYPYAYYMEAGSRKNLFEYQQAQLEAEIENLSWKIERAETT 481
            :||:.|:|..|..:|.:||.||.:||.:|:|::..::..:||..||.||...|.||..:||..:.
Zfish   427 SWIEVQFLKKAVDVLCQCRSTLMFTYVFAFYLKKNNQSIIFENNQADLENATEVLSGYLERDISQ 491

  Fly   482 D-LGDLENQMD----IAEKRRTTLLK 502
            | |.|::.::.    ..|.||..||:
Zfish   492 DSLQDIKQKVQDKYRYCESRRRVLLQ 517

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763 22/62 (35%)
arih1lNP_998088.1 TRIAD supradomain. {ECO:0000255|PROSITE-ProRule:PRU01221} 158..369 92/212 (43%)
IBR 233..293 CDD:214763 22/61 (36%)
IBR <315..355 CDD:279784 27/40 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D429758at33208
OrthoFinder 1 1.000 FOG0000641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126891
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.