DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and park

DIOPT Version :9

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster


Alignment Length:363 Identity:87/363 - (23%)
Similarity:139/363 - (38%) Gaps:89/363 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DVERLDPKRADPEYFEY--ECLTVEDIEKLLNERVEKLNTILQITPSLAK-VLLLEHQ----WNN 88
            |.||:   ||...:|.:  :|      :||.|.:       |::..:|.| .....|:    |::
  Fly   149 DEERV---RAKAHFFVHCSQC------DKLCNGK-------LRVRCALCKGGAFTVHRDPECWDD 197

  Fly    89 VAVVEKYRQDANALLVTARIKPPSVAVTDTASTSAAAAS-----AQLLRLGSSGYKTTASATPQY 148
            |.   |.|:      :....:...||..|.|:.....|.     |:.:   |.|.|..|:.....
  Fly   198 VL---KSRR------IPGHCESLEVACVDNAAGDPPFAEFFFKCAEHV---SGGEKDFAAPLNLI 250

  Fly   149 RSQM--CPVCASSQLGDKFYSLACG--HSFCKDCWTIYFETQIFQ-------GISTQIGCMAQMC 202
            ::.:  .|..|.:.:.|......|.  |..|.||:..|..:::.:       .....:.|.|...
  Fly   251 KNNIKNVPCLACTDVSDTVLVFPCASQHVTCIDCFRHYCRSRLGERQFMPHPDFGYTLPCPAGCE 315

  Fly   203 NVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFCPGPNC--QIIVQSSEISAKRAICK- 264
            :..:.|.....|:||... |:||:||.::||.....: .||.|.|  .::|   |...::..|: 
  Fly   316 HSFIEEIHHFKLLTREEY-DRYQRFATEEYVLQAGGV-LCPQPGCGMGLLV---EPDCRKVTCQN 375

  Fly   265 ACHTGFCFRCGMDYH------------APTDCQVI--------KKWLTKCADDSETANY-ISAHT 308
            .|...||..|...||            |...|:..        .:|       .|.:|. |...|
  Fly   376 GCGYVFCRNCLQGYHIGECLPEGTGASATNSCEYTVDPNRAAEARW-------DEASNVTIKVST 433

  Fly   309 KDCPKCHICIEKNGGCNHMQC--FNCKHDFCWMCLGDW 344
            |.||||....|::|||.||.|  ..|..::||:|..:|
  Fly   434 KPCPKCRTPTERDGGCMHMVCTRAGCGFEWCWVCQTEW 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 151..204 CDD:319687 11/63 (17%)
IBR 222..284 CDD:214763 21/76 (28%)
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 18/59 (31%)
IBR <435..471 CDD:279784 15/35 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446175
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.