DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and park

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_730600.1 Gene:park FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster

Alignment Length:363 Identity:87/364 (24%)
Similarity:139/364 (38%) Gaps:89/364 (24%)


  Fly    31 DVERLDPKRADPEYFEY--ECLTVEDIEKLLNERVEKLNTILQITPSLAK-VLLLEHQ----WNN 88
            |.||:   ||...:|.:  :|      :||.|.:       |::..:|.| .....|:    |::
  Fly   149 DEERV---RAKAHFFVHCSQC------DKLCNGK-------LRVRCALCKGGAFTVHRDPECWDD 197

  Fly    89 VAVVEKYRQDANALLVTARIKPPSVAVTDTASTSAAAAS-----AQLLRLGSSGYKTTASATPQY 148
            |.   |.|:      :....:...||..|.|:.....|.     |:.:   |.|.|..|:.....
  Fly   198 VL---KSRR------IPGHCESLEVACVDNAAGDPPFAEFFFKCAEHV---SGGEKDFAAPLNLI 250

  Fly   149 RSQM--CPVCASSQLGDKFYSLACG--HSFCKDCWTIYFETQIFQ-------GISTQIGCMAQMC 202
            ::.:  .|..|.:.:.|......|.  |..|.||:..|..:::.:       .....:.|.|...
  Fly   251 KNNIKNVPCLACTDVSDTVLVFPCASQHVTCIDCFRHYCRSRLGERQFMPHPDFGYTLPCPAGCE 315

  Fly   203 NVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFCPGPNC--QIIVQSSEISAKRAICK- 264
            :..:.|.....|:||... |:||:||.::||.....: .||.|.|  .::|   |...::..|: 
  Fly   316 HSFIEEIHHFKLLTREEY-DRYQRFATEEYVLQAGGV-LCPQPGCGMGLLV---EPDCRKVTCQN 375

  Fly   265 ACHTGFCFRCGMDYH------------APTDCQVI--------KKWLTKCADDSETANY-ISAHT 308
            .|...||..|...||            |...|:..        .:|       .|.:|. |...|
  Fly   376 GCGYVFCRNCLQGYHIGECLPEGTGASATNSCEYTVDPNRAAEARW-------DEASNVTIKVST 433

  Fly   309 KDCPKCHICIEKNGGCNHMQC--FNCKHDFCWMCLGDW 344
            |.||||....|::|||.||.|  ..|..::||:|..:|
  Fly   434 KPCPKCRTPTERDGGCMHMVCTRAGCGFEWCWVCQTEW 471

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763 21/77 (27%)
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 19/60 (32%)
IBR <435..471 CDD:279784 15/36 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64638404
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11685
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.