DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and CG12362

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_648392.1 Gene:CG12362 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster

Alignment Length:526 Identity:165/527 (31%)
Similarity:272/527 (52%) Gaps:60/527 (11%)


  Fly     1 MDSDIEMDMESDNDG----------EYDDDYDYYNTGEDCDVERLDPKRA---DPEYFEYECLTV 52
            |:|::|...|...|.          |.|.|      .||...|.|.|:.:   :.|.|.|:.|:|
  Fly     1 MNSEMEFSDEDHGDSHRSLLTHMSCENDSD------SEDTCTEILLPENSNSPETEDFVYKVLSV 59

  Fly    53 EDIEKLLNERVEKLNTILQITPSLAKVLLLEHQWNNVAVVEKY-RQDANALLVTARIKPP---SV 113
            :.|.:.....::::|.:|.:.|.:.:::|...:|:..::.|.| ..:.......|.:..|   .:
  Fly    60 DQIVQHQRNIIDEVNNVLNLPPQVTRIILNHFKWDKESLFENYFESNPKDFFQRAHVLNPFEKKI 124

  Fly   114 AVTDTASTSAAAASAQLLRLGSSGYKTTASATPQYRSQMCPVCASSQLGDKFYSLACGHSFCKDC 178
            .....||||.|.                        .|:|.:|..|  .|:...|.|||:||..|
  Fly   125 ERESAASTSCAI------------------------PQLCGICFCS--CDELIGLGCGHNFCAAC 163

  Fly   179 WTIYFETQ-IFQGISTQIGCMAQMCNVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFC 242
            |..|...: ..:|::..|.|.|..|.:.|.....|.|.....:.::|||.....:|:.:..:|:|
  Fly   164 WKQYLANKTCSEGLANTIKCPAANCEILVDYISFLKLADDSEVVERYQQLITNTFVECNMLMRWC 228

  Fly   243 PGPNCQIIVQSSEISAKRAICKACHTGFCFRCGMDYHAPTDCQVIKKWLTKCADDSETANYISAH 307
            |.|||...|::.....:..:||..|. |||.||.::|.|..|..:|||:.||.:||||:|:|:.:
  Fly   229 PAPNCSHAVKAVCAEPRAVLCKCGHE-FCFACGENWHEPASCSSLKKWVKKCLEDSETSNWIAQN 292

  Fly   308 TKDCPKCHICIEKNGGCNHMQCFN--CKHDFCWMCLGDWKTHGSEYYECSRYKDNPNIANESVHV 370
            ||:||||::.|||:||||||.|.|  |::||||:|||.|:.|||.:|.|:|:.:...........
  Fly   293 TKECPKCNVTIEKDGGCNHMVCKNPSCRYDFCWVCLGSWEPHGSSWYSCNRFDEEEAKQARLAQQ 357

  Fly   371 QAREALKKYLHYYERWENHSKSLKLEQQTIDRLRQRINSKVMNGSGTWIDWQYLFNAAALLAKCR 435
            :.|.::.:|||||.|:.||.:|||:|.:....::.:::.  |....:||:.|:|.:|..:|.:||
  Fly   358 KYRSSMARYLHYYNRYSNHMQSLKMENKLYSNIQAKMDD--MQEEMSWIEVQFLRDAVDVLCQCR 420

  Fly   436 YTLQYTYPYAYYMEAGSRKNLFEYQQAQLEAEIENLSWKIERAETT-DLGDLENQ-MDIA---EK 495
            .||.|:|.:|:|:...::|.:||..|..:|...|.||..:||..|. ::.:::.: :|::   :|
  Fly   421 TTLMYSYVFAFYLMNNNQKIIFEDNQKDMEMATEKLSECLEREITVKNIYEVKQKVLDLSHYCQK 485

  Fly   496 RRTTLL 501
            ||..||
  Fly   486 RRHVLL 491

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763 21/62 (34%)
CG12362NP_648392.1 IBR 208..269 CDD:214763 21/62 (34%)
IBR 273..331 CDD:279784 36/58 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64727669
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 241 1.000 Inparanoid score I684
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D429758at33208
OrthoFinder 1 1.000 FOG0000641
orthoMCL 1 0.900 OOG5_126891
Panther 1 1.100 P PTHR11685
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.