DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and Cul9

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001178511.1 Gene:Cul9 RGDID:1562008 Length:2514 Species:Rattus norvegicus

Alignment Length:465 Identity:118/466 (25%)
Similarity:182/466 (39%) Gaps:80/466 (17%)


  Fly    50 LTVEDIEKLLNERVEKLNTILQITPSLAKVLLLEHQWNNVAVVEKYRQDANALLVTARIKPPSVA 114
            ::.:::|.|:.:.|.::...|.:.|.:|:.||....|....:::.|.:|...||:.|.::.|.  
  Rat  1991 MSPQEVEGLMEQTVRQVQETLNLEPDVAQHLLAYSHWGTEQLLQSYSEDPEPLLLAAGLRVPQ-- 2053

  Fly   115 VTDTASTSAAAASAQLLRLGSSGYKTTASATPQ---YRSQMCPVCASSQLG--DKFYSLACGHSF 174
                                           ||   .|...||||. |.||  |...||.|.|..
  Rat  2054 -------------------------------PQEVPARPDQCPVCI-SPLGPNDDSPSLCCLHCC 2086

  Fly   175 CKDCWTIYFETQIFQGISTQIGCMAQMCNVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPEL 239
            ||.||..|..|:|.|.......|....|..:.....:..:|:.|.:..||::...:.||:|...|
  Rat  2087 CKSCWNEYLTTRIEQNFVLNCTCPIADCPAQPTGAFIRNIVSSPEVISKYEKALLRGYVESCSNL 2151

  Fly   240 RFCPGP-NCQIIVQSSEISAKRAICKACHTGFCFRCGM-DYHAPTDCQVIKKWLTKCADD----- 297
            .:|..| .|..|:....:.: ...|..|....||.|.. :.|.|..|..:.:|:    ||     
  Rat  2152 TWCTNPQGCDRILCRQGLGS-GTTCSKCGWASCFNCSFPEAHYPASCGHMSQWV----DDGGYYD 2211

  Fly   298 -----SETANYISAHTKDCPKCHICIEKNGGCNHMQCFNCKHDFCWMCLGDWKTHGSEYYECSRY 357
                 :::.:.....:|.||.|...||||.||.||.|..|.|.|||.||..||....:||.||  
  Rat  2212 GMSVEAQSKHLAKLISKRCPSCQAPIEKNEGCLHMTCARCNHGFCWRCLRSWKPSHKDYYNCS-- 2274

  Fly   358 KDNPNIANESVHVQAREALKKYLHYYERWENHSKSLKLEQQTIDRLRQRINSKVMNGSGTWIDWQ 422
                    ..|...||:. |::..|.||...|.::.:.      .:..|..:..::.......:.
  Rat  2275 --------AMVSKAARQE-KRFQDYNERCTFHHQAREF------AVNLRNQASAIHEVPPPKSFT 2324

  Fly   423 YLFNAAALLAKCRYTLQYTYPYAYYMEAGSRKNLFEYQQAQLEAEIENLSWKIERAETTDLGDLE 487
            :|.:|...|.:.|..|.|...|::|.:.....::.|.|...||.....|...:|  ||     |.
  Rat  2325 FLQDACRALEQARKVLAYACVYSFYSQGTEYMDVVEQQTENLELHTNALQILLE--ET-----LL 2382

  Fly   488 NQMDIAEKRR 497
            ...|:|...|
  Rat  2383 RCQDLASSLR 2392

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763 17/64 (27%)
Cul9NP_001178511.1 Cul7 366..440 CDD:288381
APC10-like 1160..1290 CDD:295192
CULLIN 1586..1757 CDD:214545
Cullin_Nedd8 1857..1937 CDD:214883
IBR 2135..2197 CDD:214763 17/63 (27%)
IBR <2228..2263 CDD:279784 20/35 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.