DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and C17H11.4

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_509380.1 Gene:C17H11.4 WormBaseID:WBGene00015924 Length:115 Species:Caenorhabditis elegans

Alignment Length:81 Identity:35/82 (43%)
Similarity:49/82 (60%) Gaps:8/82 (10%)


  Fly   417 TWIDWQYLFNAAALLAKCRYTLQYTYPYAYYMEAGSRKNLFEYQQAQLEAEIENLSWKIERAETT 481
            :||:.|:|......|::||.||:|.|.:|||:||.:...|||..|:.||...|.||..:|     
 Worm     2 SWIEVQFLRQPVDALSECRRTLKYAYAFAYYLEANNLTTLFETNQSDLELATEQLSGMLE----- 61

  Fly   482 DLGDLENQMDIAEKRR 497
              ||||: ||:||.:|
 Worm    62 --GDLED-MDLAELKR 74

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763
C17H11.4NP_509380.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D469819at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.