DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and C17H11.4

DIOPT Version :9

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001359873.1 Gene:C17H11.4 / 182752 WormBaseID:WBGene00015924 Length:94 Species:Caenorhabditis elegans


Alignment Length:81 Identity:35/81 - (43%)
Similarity:49/81 - (60%) Gaps:8/81 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 TWIDWQYLFNAAALLAKCRYTLQYTYPYAYYMEAGSRKNLFEYQQAQLEAEIENLSWKIERAETT 481
            :||:.|:|......|::||.||:|.|.:|||:||.:...|||..|:.||...|.||..:|     
 Worm     2 SWIEVQFLRQPVDALSECRRTLKYAYAFAYYLEANNLTTLFETNQSDLELATEQLSGMLE----- 61

  Fly   482 DLGDLENQMDIAEKRR 497
              ||||: ||:||.:|
 Worm    62 --GDLED-MDLAELKR 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 151..204 CDD:319687
IBR 222..284 CDD:214763
C17H11.4NP_001359873.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469819at2759
OrthoFinder 1 1.000 - - FOG0000379
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.