DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ari-2 and C17H11.4

DIOPT Version :10

Sequence 1:NP_477374.1 Gene:ari-2 / 37542 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001359873.1 Gene:C17H11.4 / 182752 WormBaseID:WBGene00015924 Length:94 Species:Caenorhabditis elegans


Alignment Length:81 Identity:35/81 - (43%)
Similarity:49/81 - (60%) Gaps:8/81 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 TWIDWQYLFNAAALLAKCRYTLQYTYPYAYYMEAGSRKNLFEYQQAQLEAEIENLSWKIERAETT 481
            :||:.|:|......|::||.||:|.|.:|||:||.:...|||..|:.||...|.||..:|     
 Worm     2 SWIEVQFLRQPVDALSECRRTLKYAYAFAYYLEANNLTTLFETNQSDLELATEQLSGMLE----- 61

  Fly   482 DLGDLENQMDIAEKRR 497
              ||||: ||:||.:|
 Worm    62 --GDLED-MDLAELKR 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 RING-HC_RBR_TRIAD1 152..204 CDD:438429
BRcat_RBR_TRIAD1 231..302 CDD:439005
Rcat_RBR_TRIAD1 306..361 CDD:439021
Ariadne 371..>477 CDD:466073 25/59 (42%)
C17H11.4NP_001359873.1 Ariadne <16..>61 CDD:466073 21/44 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.