DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and ari-1.4

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001041060.1 Gene:ari-1.4 WormBaseID:WBGene00013538 Length:485 Species:Caenorhabditis elegans

Alignment Length:508 Identity:174/509 (34%)
Similarity:267/509 (52%) Gaps:67/509 (13%)


  Fly     1 MDSDIEMDME-SDNDGEYDDDYDYY--NTGED---CDVERLDPKRADPEYFEYECLTVEDIEKLL 59
            |.||.|:..| :|.|.|:.||.|..  ::||.   .:.|.|||...:           .|:.|.:
 Worm     1 MSSDDEIYNENNDLDEEFSDDMDQQSGSSGESQGKANYEILDPTALE-----------SDMSKTI 54

  Fly    60 NERVEKLNTILQITPSLAKVLLLEHQWNNVAVVEKY--RQDANALLVTARIKPPSVAVTDTASTS 122
            :|    :..|||:.|.:.::||.:.:||...:::|:  ..|....|..|::.|      .|:|:.
 Worm    55 SE----VQAILQVEPGICRILLHKFKWNKDRLLDKFYEHSDTTEFLAEAQVIP------KTSSSE 109

  Fly   123 AAAASAQLLRLGSSGYKTTASATPQYRSQMCPVCASSQLGDKFYSLACGHSFCKDCWTIYFETQI 187
            .||.|               ||.|......|.||.|.   .:...|||.|..|.:||..|...:|
 Worm   110 EAAGS---------------SAPPPGGDAECDVCCSM---TRLSGLACAHRACDECWKAYLTEKI 156

  Fly   188 FQGISTQIGCMAQMCNVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFCPGPNCQIIVQ 252
            .....::|.||...|.:.:.::.|::.:|.|.:...|::.....||:::.:|::|||..|...|:
 Worm   157 VDVGQSEIECMMMDCKLLIEDEKVMSYITDPFVIAAYRKLIISSYVETNSQLKWCPGAGCGKAVK 221

  Fly   253 SSEISAKRAICKACHTGFCFRCGMDYHAPTDCQVIKKWLTKCADDSETANYISAHTKDCPKCHIC 317
            ......:.|:| .|...|||.|..|:|.|..|:.:|.|..||:|||||.|:|:|:||.||||.:.
 Worm   222 GEPSDREPAVC-TCGERFCFACAQDWHDPLSCRHMKMWRKKCSDDSETLNWINANTKPCPKCSVT 285

  Fly   318 IEKNGGCNHMQC--FNCKHDFCWMCLGDWKTHGSEYYECSRYKDNPNIANESVHVQAREALKKYL 380
            ||||||||||.|  .:|:::|||:||||||.|.    :|:||.::.|..:.  ...:|:.|::||
 Worm   286 IEKNGGCNHMSCKSSSCRYEFCWLCLGDWKNHA----QCNRYVEDDNKTDS--RSLSRKNLQRYL 344

  Fly   381 HYYERWENHSKSLKLEQQTIDRLRQRINSKVMNG-SGTWIDWQYLFNAAALLAKCRYTLQYTYPY 444
            .||.|:..|..|:|||.:...::..:::  :|.. |.:||:.|:|..|...|.:||.||:|.|.:
 Worm   345 FYYNRFMAHQNSMKLEGKLYAKVEVKMD--LMQALSMSWIEVQFLRRAVDALCECRRTLKYAYAF 407

  Fly   445 AYYMEAGSRKNLFEYQQAQLEAEIENLSWKIERAETTDLGDLENQMDIAEKRR 497
            |||:||.:...|||..|:.||...|.||..:|       ||||:. |:||.:|
 Worm   408 AYYLEANNMTTLFETNQSDLELATEQLSGMLE-------GDLEDN-DLAELKR 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763 19/62 (31%)
ari-1.4NP_001041060.1 IBR 193..252 CDD:214763 19/60 (32%)
IBR <273..314 CDD:279784 26/41 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D429758at33208
OrthoFinder 1 1.000 FOG0000641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126891
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.