DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ari-2 and ari-2

Sequence 1:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_500829.2 Gene:ari-2 WormBaseID:WBGene00020462 Length:482 Species:Caenorhabditis elegans

Alignment Length:512 Identity:249/513 (49%)
Similarity:329/513 (64%) Gaps:38/513 (7%)


  Fly     1 MDSDIEMDMESDNDGEYDDDYDYYNTGEDCDVERLDPKRADPEYFE---YECLTVEDIEKLLNER 62
            || |.:|...|.:|.....|.||||   :.||:..|.....|.:.|   ||||:|..:|::..:.
 Worm     1 MD-DEDMSCTSGDDYAGYGDEDYYN---EADVDAADDVAVTPTHSEEADYECLSVNQVERVFIDG 61

  Fly    63 VEKLNTILQITPSLAKVLLLEHQWNNVAVVEKYRQDANALLVTARI--KP-PSVAVTDTASTSAA 124
            |..|.:.:.|....|::||..:.|:...:....|.|.|..|....|  || |...::.|.|..| 
 Worm    62 VNSLVSRISINEKFARILLQANHWDVDKIARLVRNDRNDFLRKCHIDAKPEPKRKLSSTQSVLA- 125

  Fly   125 AASAQLLRLGSSGYKTTASATPQYRSQMCPVCASSQLGDKFYSLACGHSFCKDCWTIYFETQIFQ 189
                       .||              |.|||.... .:...|.|||.||:.||..:.|:::.:
 Worm   126 -----------KGY--------------CSVCAMDGY-TELPHLTCGHCFCEHCWKSHVESRLSE 164

  Fly   190 GISTQIGCMAQMCNVRVPEDLVLTLV-TRPVMRDKYQQFAFKDYVKSHPELRFCPGPNCQIIVQS 253
            |::::|.||...|.|..|.:.||::: ..||::.||::|..:|.|.|||.|:||.|..|.:|::|
 Worm   165 GVASRIECMESECEVYAPSEFVLSIIKNSPVIKLKYERFLLRDMVNSHPHLKFCVGNECPVIIRS 229

  Fly   254 SEISAKRAICKACHTGFCFRCGMDYHAPTDCQVIKKWLTKCADDSETANYISAHTKDCPKCHICI 318
            :|:..||..|..|||.||.:||.||||||.|:.||:|:|||||||||||||||||||||:||.||
 Worm   230 TEVKPKRVTCMQCHTSFCVKCGADYHAPTSCETIKQWMTKCADDSETANYISAHTKDCPQCHSCI 294

  Fly   319 EKNGGCNHMQCFNCKHDFCWMCLGDWKTHGSEYYECSRYKDNPNIANESVHVQAREALKKYLHYY 383
            ||.|||||:||..|:|.|||||.||||:||||||||||||:||::|.|:.||:||.||:|||||:
 Worm   295 EKAGGCNHIQCTRCRHHFCWMCFGDWKSHGSEYYECSRYKENPSVAAEANHVKARRALEKYLHYF 359

  Fly   384 ERWENHSKSLKLEQQTIDRLRQRINSKVMNGSGTWIDWQYLFNAAALLAKCRYTLQYTYPYAYYM 448
            ||:||||||||:|::..|::|::|:.||...:|||||||||..:.:||.|||||||||||:||::
 Worm   360 ERFENHSKSLKMEEELRDKIRKKIDDKVNEHNGTWIDWQYLHKSVSLLTKCRYTLQYTYPFAYFL 424

  Fly   449 EAGSRKNLFEYQQAQLEAEIENLSWKIERAETTDLGDLENQMDIAEKRRTTLLKDFF 505
            .|..|||||||||||||.|:|.|:|.:|||:.|..|.||..|..||.:|.|||.|||
 Worm   425 SATPRKNLFEYQQAQLEKEVEELAWAVERADGTARGALEAHMHRAEHKRQTLLHDFF 481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ari-2NP_477374.1 IBR 222..284 CDD:214763 32/62 (52%)
ari-2NP_500829.2 IBR 199..260 CDD:214763 24/62 (39%)
IBR 272..320 CDD:303000 38/48 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C252062093
eggNOG 1 0.900 E1_KOG1812
Hieranoid 1 1.000
Homologene 1 1.000 H48424
Inparanoid 1 1.050 512 1.000 Inparanoid score I704
Isobase 1 0.950 0 Normalized mean entropy S1372
OMA 1 1.010
OrthoDB 1 1.010 D429758at33208
OrthoFinder 1 1.000 FOG0000641
OrthoInspector 1 1.000 T477178
orthoMCL 1 0.900 OOG5_126891
Panther 1 1.100 LDO PTHR11685
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2404
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.